--- license: apache-2.0 --- # ProLLaMA: A Protein Large Language Model for Multi-Task Protein Language Processing [Paper on arxiv](https://arxiv.org/abs/2402.16445) for more information [Github](https://github.com/Lyu6PosHao/ProLLaMA) for more information ProLLaMA is based on Llama-2-7b, so please follow the license of Llama2. # Input Format: The instructions which you input to the model should follow the following format: ```text [Generate by superfamily] Superfamily=<xxx> or [Determine superfamily] Seq=<yyy> ``` Here are some examples of the input: ```text [Generate by superfamily] Superfamily=<Ankyrin repeat-containing domain superfamily> ``` ``` #You can also specify the first few amino acids of the protein sequence: [Generate by superfamily] Superfamily=<Ankyrin repeat-containing domain superfamily> Seq=<MKRVL ``` ``` [Determine superfamily] Seq=<MAPGGMPREFPSFVRTLPEADLGYPALRGWVLQGERGCVLYWEAVTEVALPEHCHAECWGVVVDGRMELMVDGYTRVYTRGDLYVVPPQARHRARVFPGFRGVEHLSDPDLLPVRKR> ``` **See [this](https://github.com/Lyu6PosHao/ProLLaMA/blob/main/superfamilies.txt) on all the optional superfamilies.** # Quick usage: ```bash # you can replace the model_path with your local path CUDA_VISIBLE_DEVICES=0 python main.py --model "GreatCaptainNemo/ProLLaMA" --interactive # main.py is as follows 👇: ``` ```python import argparse import json, os import torch from transformers import LlamaForCausalLM, LlamaTokenizer from transformers import GenerationConfig from tqdm import tqdm generation_config = GenerationConfig( temperature=0.2, top_k=40, top_p=0.9, do_sample=True, num_beams=1, repetition_penalty=1.2, max_new_tokens=400 ) parser = argparse.ArgumentParser() parser.add_argument('--model', default=None, type=str,help="The local path of the model. If None, the model will be downloaded from HuggingFace") parser.add_argument('--interactive', action='store_true',help="If True, you can input instructions interactively. If False, the input instructions should be in the input_file.") parser.add_argument('--input_file', default=None, help="You can put all your input instructions in this file (one instruction per line).") parser.add_argument('--output_file', default=None, help="All the outputs will be saved in this file.") args = parser.parse_args() if __name__ == '__main__': if args.interactive and args.input_file: raise ValueError("interactive is True, but input_file is not None.") if (not args.interactive) and (args.input_file is None): raise ValueError("interactive is False, but input_file is None.") if args.input_file and (args.output_file is None): raise ValueError("input_file is not None, but output_file is None.") load_type = torch.bfloat16 if torch.cuda.is_available(): device = torch.device(0) else: raise ValueError("No GPU available.") model = LlamaForCausalLM.from_pretrained( args.model, torch_dtype=load_type, low_cpu_mem_usage=True, device_map='auto', quantization_config=None ) tokenizer = LlamaTokenizer.from_pretrained(args.model) model.eval() with torch.no_grad(): if args.interactive: while True: raw_input_text = input("Input:") if len(raw_input_text.strip())==0: break input_text = raw_input_text input_text = tokenizer(input_text,return_tensors="pt") generation_output = model.generate( input_ids = input_text["input_ids"].to(device), attention_mask = input_text['attention_mask'].to(device), eos_token_id=tokenizer.eos_token_id, pad_token_id=tokenizer.pad_token_id, generation_config = generation_config, output_attentions=False ) s = generation_output[0] output = tokenizer.decode(s,skip_special_tokens=True) print("Output:",output) print("\n") else: outputs=[] with open(args.input_file, 'r') as f: examples =f.read().splitlines() print("Start generating...") for index, example in tqdm(enumerate(examples),total=len(examples)): input_text = tokenizer(example,return_tensors="pt") #add_special_tokens=False ? generation_output = model.generate( input_ids = input_text["input_ids"].to(device), attention_mask = input_text['attention_mask'].to(device), eos_token_id=tokenizer.eos_token_id, pad_token_id=tokenizer.pad_token_id, generation_config = generation_config ) s = generation_output[0] output = tokenizer.decode(s,skip_special_tokens=True) outputs.append(output) with open(args.output_file,'w') as f: f.write("\n".join(outputs)) print("All the outputs have been saved in",args.output_file) ``` # Citation: ``` @article{lv2024prollama, title={ProLLaMA: A Protein Large Language Model for Multi-Task Protein Language Processing}, author={Lv, Liuzhenghao and Lin, Zongying and Li, Hao and Liu, Yuyang and Cui, Jiaxi and Chen, Calvin Yu-Chian and Yuan, Li and Tian, Yonghong}, journal={arXiv preprint arXiv:2402.16445}, year={2024} } ```