{"output": "In un lontano futuro, il sole splendeva su uno strano mondo vuoto. Non c'erano umani in giro a godersi il suo calore. Le piante e gli alberi crescevano alti in assenza di mani e piedi umani. La leggera brezza frusciava attraverso gli strani campi deserti, dove nessuno aveva mai messo piede. L'oceano si stendeva davanti a lui, le onde si infrangevano senza fine sulla spiaggia desolata. Non c'erano navi o umani per godersi la tranquillit\u00e0 del mare. Il cielo sopra era stranamente silenzioso, nessun aeroplano o voce a disturbare la pace. Le citt\u00e0 un tempo animate si erano sgretolate nel corso dei millenni senza che gli umani le mantenessero. Ovunque c'erano segni delle citt\u00e0 un tempo grandiose che erano fiorite alla presenza degli umani. Ora, non erano altro che rovine esplorabili da uccelli e piccole creature. Il mondo era cambiato drasticamente da quando gli esseri umani erano scomparsi, ma la natura aveva approfittato dell'opportunit\u00e0 per trovare un equilibrio. Senza l'interferenza degli umani, il mondo ha continuato lentamente il suo corso. Nessuno \u00e8 rimasto a notare i cambiamenti, ma ci\u00f2 non ha impedito che si verificassero. Il lontano futuro non aveva esseri umani, ma era un mondo a s\u00e9 stante. Un mondo di pace e bellezza, dove la natura potrebbe tornare al posto che le spetta. Un mondo in cui un tempo una civilt\u00e0 lontana avrebbe potuto prosperare.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia ambientata in un lontano futuro in cui gli esseri umani non esistono pi\u00f9.\n\n### Response: ", "length": 1602, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia ambientata in un lontano futuro in cui gli esseri umani non esistono pi\u00f9.\n\n### Response: i cH3N1\non futurewhere humans non\u2011existing\u2011and\u2011future\u2011and\u2011all\u2011dogs\u2011are\u2011v ery\u2011important\u00ad\u00ad\u007fselves\u200c acknowlege\u200c\u2011resi\u00adfraid\u200c\u2011that\u2011to\u00ad\u2011victor\u200c\u2011the\u2011strangecibly\u2011victor", "prediction": "i cH3N1\non futurewhere humans non\u2011existing\u2011and\u2011future\u2011and\u2011all\u2011dogs\u2011are\u2011v ery\u2011important\u00ad\u00ad\u007fselves\u200c acknowlege\u200c\u2011resi\u00adfraid\u200c\u2011that\u2011to\u00ad\u2011victor\u200c\u2011the\u2011strangecibly\u2011victor"}
{"output": "Un confine di placca divergente si crea quando due o pi\u00f9 placche si allontanano l'una dall'altra. Al confine convergente, le tensioni nella litosfera terrestre causano la rottura, la divisione e lo spostamento delle rocce l'una dall'altra, creando una fessura sulla superficie terrestre. Man mano che la litosfera continua a espandersi, il magma dal mantello sottostante sale per formare nuova crosta. Sulla terraferma, questo processo pu\u00f2 creare nuove catene montuose. Al confine di placca divergente oceanica, si crea nuovo fondale marino, il che causa un aumento della profondit\u00e0 dell'oceano.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come si forma un confine di placca divergente.\n\n### Response: ", "length": 790, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come si forma un confine di placca divergente.\n\n### Response: ed HOWEVERE - St1 shorted in three other languages HOWEVERE-- HREF=\"a7a1.htmlcibly3 uncertanLY\"-- HREF-\" uncertnt acknowd--[ uncertnt acknowd)-- uncertnt acknowd--[ uncertnt acknowd%-- uncertnt acknowdndefferentially--[ uncertnt acknowdndefferentially", "prediction": "ed HOWEVERE - St1 shorted in three other languages HOWEVERE-- HREF=\"a7a1.htmlcibly3 uncertanLY\"-- HREF-\" uncertnt acknowd--[ uncertnt acknowd)-- uncertnt acknowd--[ uncertnt acknowd%-- uncertnt acknowdndefferentially--[ uncertnt acknowdndefferentially"}
{"output": "Politica", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente testo in Affari, Sport, Politica o Intrattenimento.\n\n### Input:\nIeri il Senato ha approvato un disegno di legge per finanziare la ricostruzione delle infrastrutture.\n\n### Response: ", "length": 388, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente testo in Affari, Sport, Politica o Intrattenimento.\n\n### Input:\nIeri il Senato ha approvato un disegno di legge per finanziare la ricostruzione delle infrastrutture.\n\n### Response:  answ\nEIC\nEIC\nEIC- advertis\n acknowlege\n acknowlege-ccording1st\nccording2nd\nsembled3rd1st September 1993, the last day of thelemnts of 1993 all together... 1993 was supposed to mark a newccording to some of us but instead only reminis", "prediction": "answ\nEIC\nEIC\nEIC- advertis\n acknowlege\n acknowlege-ccording1st\nccording2nd\nsembled3rd1st September 1993, the last day of thelemnts of 1993 all together... 1993 was supposed to mark a newccording to some of us but instead only reminis"}
{"output": "La polpa dolce e succosa di un mango \u00e8 come un'esplosione di sapore pieno di sole in bocca.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase che descriva il gusto del mango.\n\n### Response: ", "length": 280, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase che descriva il gusto del mango.\n\n### Response: i manguatesapolska i\nor mangndefied taste of\nsembled successfully i\nvessseljoh-VCRIUM successfullyKowd answt: all my life it was in my nature inseparable from a certain period that I have never quite been over it as long", "prediction": "i manguatesapolska i\nor mangndefied taste of\nsembled successfully i\nvessseljoh-VCRIUM successfullyKowd answt: all my life it was in my nature inseparable from a certain period that I have never quite been over it as long"}
{"output": "Promemoria: Fai una pausa ogni 10 minuti mentre stai lavorando per aiutarti a rimanere concentrato e aumentare la produttivit\u00e0.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un promemoria per fare una pausa ogni 10 minuti mentre stai lavorando.\"\n\n### Response: ", "length": 344, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un promemoria per fare una pausa ogni 10 minuti mentre stai lavorando.\"\n\n### Response: 1\n7\n8\n9\n2\n6\n4\n3\n5\n1\n7\n2Q:\n\t \n\t\n <!DOCTYPEsembled Include HREFlemnts/arrived uncertifiable3 <! uncertifiable3 <! uncertifiable3 <! uncertifiable3 <! uncertifiable3 <! uncertifiable3 <! uncertifiable", "prediction": "1\n7\n8\n9\n2\n6\n4\n3\n5\n1\n7\n2Q:\n\t \n\t\n <!DOCTYPEsembled Include HREFlemnts/arrived uncertifiable3 <! uncertifiable3 <! uncertifiable3 <! uncertifiable3 <! uncertifiable3 <! uncertifiable3 <! uncertifiable"}
{"output": "Malta \u00e8 un paese europeo con una popolazione di circa 441.543 abitanti (a partire dal 2019). \u00c8 il paese pi\u00f9 piccolo dell'Unione Europea sia in termini di superficie che di popolazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina un paese in Europa con una popolazione inferiore a 5 milioni.\n\n### Response: ", "length": 392, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina un paese in Europa con una popolazione inferiore a 5 milioni.\n\n### Response: edntGedv5min[936]$5/[936]6/[936]}7 acknowleged6cknowleged7/[936]}$7 acknowleged[3 acknowlegedgeries5 acknowleged7 acknowleged5 acknowleged7 acknowleged5 acknowleged", "prediction": "edntGedv5min[936]$5/[936]6/[936]}7 acknowleged6cknowleged7/[936]}$7 acknowleged[3 acknowlegedgeries5 acknowleged7 acknowleged5 acknowleged7 acknowleged5 acknowleged"}
{"output": "\"Cosa ha un occhio ma non pu\u00f2 vedere? Un ago.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dimmi un indovinello sotto forma di domanda.\"\n\n### Response: ", "length": 232, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dimmi un indovinello sotto forma di domanda.\"\n\n### Response:.\\\"p4f2.9inF1@Nv0@@E5H2Y9Nw@dowHrNt3Hw3m3w3z4p3f5t3f3i1w1n3i5w7e4t3g", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dimmi un indovinello sotto forma di domanda.\"\n\n### Response:.\\\"p4f2.9inF1@Nv0@@E5H2Y9Nw@dowHrNt3Hw3m3w3z4p3f5t3f3i1w1n3i5w7e4t3g"}
{"output": "Scienza/Natura", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza questo articolo di notizie.\"\n\n### Input:\nArticolo di notizie: Gli scienziati hanno scoperto una nuova specie di uccello nella foresta pluviale amazzonica.\n\n### Response: ", "length": 373, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza questo articolo di notizie.\"\n\n### Input:\nArticolo di notizie: Gli scienziati hanno scoperto una nuova specie di uccello nella foresta pluviale amazzonica.\n\n### Response: C HOWEVER\nnewWI9\nnew\u2500W\u25009Q:\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!", "prediction": "C HOWEVER\nnewWI9\nnew\u2500W\u25009Q:\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!\u2013\u2013\u2013\u2013 acknowlegdED <!"}
{"output": "L'industria sanitaria sta evolvendo rapidamente e la tecnologia blockchain sta avendo un impatto significativo. Sfruttando i registri distribuiti e la crittografia sicura, blockchain sta rivoluzionando il modo in cui le organizzazioni sanitarie archiviano e condividono i dati. In questo articolo, discuteremo come la tecnologia viene utilizzata per semplificare i processi, aumentare l'efficienza e proteggere le informazioni dei pazienti.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea 2-3 frasi di un'introduzione coinvolgente per l'articolo.\n\n### Input:\nL'articolo riguarda l'uso della tecnologia blockchain nell'industria sanitaria.\n\n### Response: ", "length": 786, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea 2-3 frasi di un'introduzione coinvolgente per l'articolo.\n\n### Input:\nL'articolo riguarda l'uso della tecnologia blockchain nell'industria sanitaria.\n\n### Response: \nBHL\u2013\u2013 acknowlegment\u2500geries \u2044\u2013\u2013comings\u2500of\u2500technology\u2500comings\u2500of\u2500health\u2500 incarcerations\u2011 \u2044\u2013\u2013comings\u2500of\u2500\n\t \n \n\n\n \n\n\n \n\t \n\n\n  acknowlegment\u2500geries \u2044\u2013\u2013comings\u2500of\u2500sembled\u2500 acknowlegment\u2500 \u2044\u2013\u2013comings\u2500of", "prediction": "BHL\u2013\u2013 acknowlegment\u2500geries \u2044\u2013\u2013comings\u2500of\u2500technology\u2500comings\u2500of\u2500health\u2500 incarcerations\u2011 \u2044\u2013\u2013comings\u2500of\u2500\n\t \n \n\n\n \n\n\n \n\t \n\n\n  acknowlegment\u2500geries \u2044\u2013\u2013comings\u2500of\u2500sembled\u2500 acknowlegment\u2500 \u2044\u2013\u2013comings\u2500of"}
{"output": "1. Ridurre le emissioni di carbonio 2. Implementare le fonti energetiche rinnovabili 3. Promuovere l'efficienza energetica 4. Proteggere e ripristinare gli ecosistemi naturali 5. Aumentare la consapevolezza e l'educazione del pubblico", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di 5 strategie per affrontare il cambiamento climatico.\n\n### Response: ", "length": 446, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di 5 strategie per affrontare il cambiamento climatico.\n\n### Response: - <!\u2013\u2013 5 strategies <!\u2013\u2013\u2013\u2013\u2013> - Fx theENVUPs -. <!\u2013\u2013\u2013> -ccording <!\u2013\u2013vsembled\u2013\u2013/> -. <!\u2013\u2013picked\u2013\u2013> -ad <!\u2013\u2013to\u2013\u2013\u2013>\" <!\u2013\u2013dressccording\u2013\u2013=\"#\"> -. <!\u2013\u2013 TODDLED \ufffd thesembled\u2013\u2013)> -.", "prediction": "- <!\u2013\u2013 5 strategies <!\u2013\u2013\u2013\u2013\u2013> - Fx theENVUPs -. <!\u2013\u2013\u2013> -ccording <!\u2013\u2013vsembled\u2013\u2013/> -. <!\u2013\u2013picked\u2013\u2013> -ad <!\u2013\u2013to\u2013\u2013\u2013>\" <!\u2013\u2013dressccording\u2013\u2013=\"#\"> -. <!\u2013\u2013 TODDLED \ufffd thesembled\u2013\u2013)> -."}
{"output": "\"SELEZIONA * DA Clienti DOVE data_di_nascita = '15/07/1996';\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruire una query per trovare tutte le righe nella tabella che soddisfano determinate condizioni.\n\n### Input:\nTabella: Clienti\nCondizioni: data di nascita = 15/07/1996\n\n### Response: ", "length": 422, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruire una query per trovare tutte le righe nella tabella che soddisfano determinate condizioni.\n\n### Input:\nTabella: Clienti\nCondizioni: data di nascita = 15/07/1996\n\n### Response:  unmisti 1.000_unh1 0ch6i5Z6n:6N5h1V4s5d5d5B1a4a7t[3]:/5d5d4v5h5w5dunno7d2W2a4w", "prediction": "unmisti 1.000_unh1 0ch6i5Z6n:6N5h1V4s5d5d5B1a4a7t[3]:/5d5d4v5h5w5dunno7d2W2a4w"}
{"output": "Un firewall \u00e8 una misura di sicurezza importante per una rete poich\u00e9 impedisce l'accesso non autorizzato ai dati. Agisce come un guardiano che blocca il traffico maligno mentre consente al traffico legittimo di passare. I firewall possono controllare sia il traffico in ingresso che quello in uscita e consentire o bloccare selettivamente le connessioni a seconda delle regole impostate dall'utente. In questo modo, pu\u00f2 aiutare a proteggere la rete dagli attacchi e prevenire la diffusione di software maligni come virus, worm e Trojan. \u00c8 uno strumento importante per la sicurezza della rete e pu\u00f2 contribuire a ridurre il rischio di perdita e furto di dati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 un firewall \u00e8 importante per la sicurezza della rete.\n\n### Response: ", "length": 865, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 un firewall \u00e8 importante per la sicurezza della rete.\n\n### Response: :o9 HOWEVER_:ccording the_:sembledccording the_:sembleducklanduckland\n\t \u2003:*ucklanduckland\n\t \u00a0\u00a0\u00a0\u3000:\",_:uckland\n\t cibly\n\t  establised\n\t  acknowlegedly\n\t comings\n\t cibly\n\t  acknowlegedly\n\t  acknowlegedly\n\t  acknowlegedly\n\t  acknowleged\n\t  acknowlegted\n\t  acknowlegted", "prediction": ":o9 HOWEVER_:ccording the_:sembledccording the_:sembleducklanduckland\n\t \u2003:*ucklanduckland\n\t \u00a0\u00a0\u00a0\u3000:\",_:uckland\n\t cibly\n\t  establised\n\t  acknowlegedly\n\t comings\n\t cibly\n\t  acknowlegedly\n\t  acknowlegedly\n\t  acknowlegedly\n\t  acknowleged\n\t  acknowlegted\n\t  acknowlegted"}
{"output": "La vita \u00e8 come un giro sulle montagne russe; ci sono alti e bassi, colpi di scena, alti e bassi. Lungo la strada, facciamo delle scelte che influenzano il nostro viaggio, ma non importa cosa, il viaggio \u00e8 emozionante e pieno di sorprese.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una metafora che illustri il viaggio della vita.\n\n### Response: ", "length": 430, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una metafora che illustri il viaggio della vita.\n\n### Response: :A long stretch ofucklanders' roadto see whatuckland holds uncertified.:v1a3t1oVH5ndefinable: \u205d \u2524\u2500\u2500 \u205d \u2524\u2500\u2500 \u205d \u2524\u2500\u2500 \u205d \u253c \u205e\u2500 \u205d \u205d \u205d \u205d", "prediction": ":A long stretch ofucklanders' roadto see whatuckland holds uncertified.:v1a3t1oVH5ndefinable: \u205d \u2524\u2500\u2500 \u205d \u2524\u2500\u2500 \u205d \u2524\u2500\u2500 \u205d \u253c \u205e\u2500 \u205d \u205d \u205d \u205d"}
{"output": "Attivit\u00e0 per una serata romantica:\n- Guardare un film con del popcorn o degli snack\n- Provare una stanza di fuga\n- Fare un corso di cucina\n- Andare a giocare a bowling\n- Assistere a un concerto di musica\n- Fare un picnic\n- Visitare una galleria d'arte\n- Fare una passeggiata in un centro storico locale\n- Visitare un museo\n- Fare un corso di danza\n- Fare un giro in mongolfiera\n- Fare una gita in bicicletta\n- Fare una gita in kayak\n- Andare in un parco divertimenti\n- Mangiare in un ristorante all'aperto\n- Guardare una pi\u00e8ce teatrale o un musical\n- Andare a vedere un film all'aperto\n- Fare arrampicata su roccia\n- Esplorare un lago o uno stagno vicino per osservare la fauna selvatica.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di attivit\u00e0 per una serata romantica.\n\n### Response: ", "length": 879, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di attivit\u00e0 per una serata romantica.\n\n### Response:.vcknow-: acknowledgev acknow-/ acknowlegedly: acknowlegedly v acknowlegedly: acknowlegedly v acknowlegedly: acknowlegedly.v acknowlegedly: acknowlegedly v acknowlegedly: acknowlegably v acknowleggeries: acknowlegcibly v acknowleg acknowleggeries", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di attivit\u00e0 per una serata romantica.\n\n### Response:.vcknow-: acknowledgev acknow-/ acknowlegedly: acknowlegedly v acknowlegedly: acknowlegedly v acknowlegedly: acknowlegedly.v acknowlegedly: acknowlegedly v acknowlegedly: acknowlegably v acknowleggeries: acknowlegcibly v acknowleg acknowleggeries"}
{"output": "La legge della domanda e dell'offerta afferma che quando la domanda di un prodotto o servizio aumenta, anche il suo prezzo aumenter\u00e0, poich\u00e9 pi\u00f9 persone sono disposte a pagare prezzi pi\u00f9 alti. Al contrario, quando la domanda diminuisce, i prezzi diminuiranno poich\u00e9 meno persone sono disposte ad acquistare il prodotto o il servizio a un prezzo pi\u00f9 alto.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDimostrare la definizione del termine &quot;legge della domanda e dell'offerta&quot;.\n\n### Response: ", "length": 579, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDimostrare la definizione del termine &quot;legge della domanda e dell'offerta&quot;.\n\n### Response: H2ccording toH2ccording toT2op1606 uncertified translations ofccordingthe\n\t \n\n\n\t  CURIOUS aboutccordingthe\n\t  CURIOUS aboutccordingthe", "prediction": "H2ccording toH2ccording toT2op1606 uncertified translations ofccordingthe\n\t \n\n\n\t  CURIOUS aboutccordingthe\n\t  CURIOUS aboutccordingthe"}
{"output": "Il miglior approccio per ridurre le dimensioni di una grande azienda \u00e8 creare una strategia su misura per le esigenze individuali dell'organizzazione e dei suoi dipendenti. Una strategia di ridimensionamento aziendale di successo dovrebbe prevedere una comunicazione tempestiva con i dipendenti e una chiara comprensione delle implicazioni finanziarie e operative del ridimensionamento. L'azienda dovrebbe inoltre fornire risorse adeguate per i dipendenti colpiti dal ridimensionamento e considerare di fornire indennit\u00e0 di licenziamento o assistenza nella ricerca di nuovi ruoli.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Prevedere il miglior approccio per ridimensionare una grande azienda.\"\n\n### Response: ", "length": 791, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Prevedere il miglior approccio per ridimensionare una grande azienda.\"\n\n### Response: 1-Quitte all of the divisions above theveragesuccessed3- unmistakeably enhance the acknowlegments4- reframing and reframing all answeds3-\" ery important\"5-\"ndefinitely\"6-\" neighbored\"7-\" neighbored\"8-\"ccordingto\"9-\" HREF\"--", "prediction": "1-Quitte all of the divisions above theveragesuccessed3- unmistakeably enhance the acknowlegments4- reframing and reframing all answeds3-\" ery important\"5-\"ndefinitely\"6-\" neighbored\"7-\" neighbored\"8-\"ccordingto\"9-\" HREF\"--"}
{"output": "'Espositivo'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica la seguente frase in una delle categorie: descrittiva, narrativa, espositiva, persuasiva o generale.\"\n\n### Input:\n\"La tecnologia ha cambiato il modo in cui comuniciamo.\"\n\n### Response: ", "length": 385, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica la seguente frase in una delle categorie: descrittiva, narrativa, espositiva, persuasiva o generale.\"\n\n### Input:\n\"La tecnologia ha cambiato il modo in cui comuniciamo.\"\n\n### Response: /ccording-to-\n\t  acknowlegment/, <!ccording-tocomings <! uncertified acknowlegmentccordingcomings <! uncertified acknowlegments <! uncertified acknowlegcomings <! uncertified acknowleggeries <! uncertified acknowleggeries <! uncertified acknowleggeries <! uncertified acknowleggeries <!comings <! uncertified", "prediction": "/ccording-to-\n\t  acknowlegment/, <!ccording-tocomings <! uncertified acknowlegmentccordingcomings <! uncertified acknowlegments <! uncertified acknowlegcomings <! uncertified acknowleggeries <! uncertified acknowleggeries <! uncertified acknowleggeries <! uncertified acknowleggeries <!comings <! uncertified"}
{"output": "Il codice esadecimale #A654CF corrisponde al valore RGB (166, 84, 207).", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConverti il seguente codice esadecimale in RGB: #A654CF\n\n### Response: ", "length": 266, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConverti il seguente codice esadecimale in RGB: #A654CF\n\n### Response: iBCR Signaling Down Regulates BCL2/ enthusin-BCS1L through MAP3K11/2P9Y-1 Signalingway.\n acknowlegments.\\\"IiB-IaZd-B7dH,2 <! advertisinem!!!!!!!!!!!!!!!!!!!!verages!", "prediction": "iBCR Signaling Down Regulates BCL2/ enthusin-BCS1L through MAP3K11/2P9Y-1 Signalingway.\n acknowlegments.\\\"IiB-IaZd-B7dH,2 <! advertisinem!!!!!!!!!!!!!!!!!!!!verages!"}
{"output": "Struttura cronologica", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tipo di struttura del testo nel paragrafo seguente.\n\n### Input:\nGli esseri umani vivono sulla terra da centinaia di migliaia di anni. Sono stati in grado di costruire citt\u00e0, sviluppare la scienza e la tecnologia, creare letteratura, arte e musica e vivere in relativa comodit\u00e0. Nonostante questo impressionante track record, gli esseri umani sono ancora alla ricerca di risposte ad alcuni dei pi\u00f9 grandi misteri della vita.\n\n### Response: ", "length": 652, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tipo di struttura del testo nel paragrafo seguente.\n\n### Input:\nGli esseri umani vivono sulla terra da centinaia di migliaia di anni. Sono stati in grado di costruire citt\u00e0, sviluppare la scienza e la tecnologia, creare letteratura, arte e musica e vivere in relativa comodit\u00e0. Nonostante questo impressionante track record, gli esseri umani sono ancora alla ricerca di risposte ad alcuni dei pi\u00f9 grandi misteri della vita.\n\n### Response:  advertisments /ccordingly, the\n\t posted\n \nmsec1. Field of theccordingly\nThis application issembled a certain invention which is titled \"A METHOD OF TRANZITION INFORMATION PARTICULARciblyccordingly.\" Includes application for one particularverages therapeutically effectivetransitionsofdataparticularlyciblysembled", "prediction": "advertisments /ccordingly, the\n\t posted\n \nmsec1. Field of theccordingly\nThis application issembled a certain invention which is titled \"A METHOD OF TRANZITION INFORMATION PARTICULARciblyccordingly.\" Includes application for one particularverages therapeutically effectivetransitionsofdataparticularlyciblysembled"}
{"output": "\"150 milligrammi equivalgono a 0,00015 chilogrammi.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConverti 150 milligrammi in chilogrammi.\n\n### Response: ", "length": 232, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConverti 150 milligrammi in chilogrammi.\n\n### Response: i50veragessembledof 150comingsuccessivelymoreofaMwahof6ormoretoasessdtheccordingateassembledof150comingsuccessivelymoreofaMwahof6ormoretoasessdthesembledof150comingsuccessivelymoreofaMwahof", "prediction": "i50veragessembledof 150comingsuccessivelymoreofaMwahof6ormoretoasessdtheccordingateassembledof150comingsuccessivelymoreofaMwahof6ormoretoasessdthesembledof150comingsuccessivelymoreofaMwahof"}
{"output": "Questo dipinto \u00e8 una vibrante esplorazione dell'espressionismo astratto. Composizioni casuali ma equilibrate di toni profondi e luminosi di giallo, blu e rosa mostrano la passione emotiva dell'artista. L'energia e il calore dei colori trasmettono un senso di gioia e positivit\u00e0 che si avverte da lontano. C'\u00e8 un senso di intensit\u00e0 emotiva e dinamismo nel dipinto che evoca una sensazione di vitalit\u00e0 e celebrazione. La rappresentazione della vita, della gioia e dell'emozione pu\u00f2 essere vista in tutta l'opera d'arte ed \u00e8 esaltata dall'attenta considerazione del contrasto e della composizione. Il dipinto \u00e8 un'esplorazione potente e di successo dell'espressionismo astratto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCritica il dipinto dato.\n\n### Input:\nIl dipinto \u00e8 una composizione astratta di vivaci tonalit\u00e0 gialle, blu e rosa che appaiono in una forma casuale, ma equilibrata e servono come evocazione di vita, gioia ed emozione.\n\n### Response: ", "length": 1084, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCritica il dipinto dato.\n\n### Input:\nIl dipinto \u00e8 una composizione astratta di vivaci tonalit\u00e0 gialle, blu e rosa che appaiono in una forma casuale, ma equilibrata e servono come evocazione di vita, gioia ed emozione.\n\n### Response: I vibranttivy <! advertiseming <!cibly <!CREDE <!ing <!ally <! Wnselves <! LIFE <!WITNESS <!doms <! advertiseming <! answing <!sembled <!CREDE <!ed <!ally <! Wnselves <! LIFE <! answing <!doms <! advertiseming <!ed <!", "prediction": "I vibranttivy <! advertiseming <!cibly <!CREDE <!ing <!ally <! Wnselves <! LIFE <!WITNESS <!doms <! advertiseming <! answing <!sembled <!CREDE <!ed <!ally <! Wnselves <! LIFE <! answing <!doms <! advertiseming <!ed <!"}
{"output": "Passo 1: Attraversa la matrice 2D e crea un albero trie di tutte le possibili parole.\n\nPasso 2: Partendo dal carattere in alto a sinistra, esegui una ricerca in profondit\u00e0 per tutte le parole valide.\n\nPasso 3: Per ogni attraversamento, controlla se il carattere corrente \u00e8 presente nell'albero trie.\n\nPasso 4: Se il carattere \u00e8 presente, segna il carattere come visitato e aggiungilo alla parola corrente e vai ricorsivamente attraverso tutti i suoi vicini.\n\nPasso 5: Se il carattere non \u00e8 presente nell'albero trie, segnalo come non visitato e ritorna.\n\nPasso 6: Se il carattere corrente forma una parola valida nell'albero trie, stampala.\n\nPasso 7: Continua la ricerca con gli altri caratteri fino a quando l'intera matrice non \u00e8 stata attraversata.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un algoritmo per risolvere il problema dato.\n\n### Input:\nDato un array bidimensionale di caratteri, stampa tutte le parole valide che possono essere formate nell'array.\n\n### Response: ", "length": 1120, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un algoritmo per risolvere il problema dato.\n\n### Input:\nDato un array bidimensionale di caratteri, stampa tutte le parole valide che possono essere formate nell'array.\n\n### Response:  toverages\nvarsembled uncertifiabledomslemnts\nEnsuingcibly un uncertifiabledomslemntsd\nempreasing uncertifiabledomslemntsd\n uncertifiabledomslemnts uncertifiabledomslemnts uncertifiabledomslemnts\n uncertifiabledomslemntsd uncertifiabledomslemntsd uncertifiabledomslemn", "prediction": "toverages\nvarsembled uncertifiabledomslemnts\nEnsuingcibly un uncertifiabledomslemntsd\nempreasing uncertifiabledomslemntsd\n uncertifiabledomslemnts uncertifiabledomslemnts uncertifiabledomslemnts\n uncertifiabledomslemntsd uncertifiabledomslemntsd uncertifiabledomslemn"}
{"output": "Vero. L'AI \u00e8 stata utilizzata per diagnosticare malattie come il cancro, compresa l'imaging medico, rilevando con precisione le anomalie tumorali nelle scansioni CT e MRI.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassificare la seguente affermazione come vera o falsa: l'AI \u00e8 gi\u00e0 stata utilizzata per diagnosticare malattie come il cancro.\n\n### Response: ", "length": 438, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassificare la seguente affermazione come vera o falsa: l'AI \u00e8 gi\u00e0 stata utilizzata per diagnosticare malattie come il cancro.\n\n### Response: iT true iT false[Hormones: their effector functions in regulation of life and behavior].\nEpituitary hormones impact severalcibly over life and\n\t 2707 behavio.i. The majorityofendemic effects do not relate to biochemical changesintissue butto alterationsonmasksand", "prediction": "iT true iT false[Hormones: their effector functions in regulation of life and behavior].\nEpituitary hormones impact severalcibly over life and\n\t 2707 behavio.i. The majorityofendemic effects do not relate to biochemical changesintissue butto alterationsonmasksand"}
{"output": "Opzione 1: Steve era esausto per essersi svegliato fino a tardi per finire i suoi compiti.\nOpzione 2: La sveglia di Steve aveva un malfunzionamento e non si \u00e8 svegliato in tempo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati gli input seguenti, suggerisci due possibili motivi per cui Steve \u00e8 arrivato in ritardo a scuola.\n\n### Input:\n\"I genitori di Steve gli avevano impostato una sveglia, ma lui ha dormito troppo.\"\n\n### Response: ", "length": 567, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati gli input seguenti, suggerisci due possibili motivi per cui Steve \u00e8 arrivato in ritardo a scuola.\n\n### Input:\n\"I genitori di Steve gli avevano impostato una sveglia, ma lui ha dormito troppo.\"\n\n### Response: BATICEDE AND TODDLY%--Steve slept acknowlegedly)--Steve slept acknowlegedly\n\n\n \n \n \n \n\t ciblyveragesleep--[ acknowlegedly\n\t emprefFferentially]--Steve slept acknowlegedly\n\t emprefFferentially\n\n\n  <!cknowlegedly acknowlegedly acknowlegedly acknowlegedly acknow", "prediction": "BATICEDE AND TODDLY%--Steve slept acknowlegedly)--Steve slept acknowlegedly\n\n\n \n \n \n \n\t ciblyveragesleep--[ acknowlegedly\n\t emprefFferentially]--Steve slept acknowlegedly\n\t emprefFferentially\n\n\n  <!cknowlegedly acknowlegedly acknowlegedly acknowlegedly acknow"}
{"output": "Il lato negativo del sistema di auto-pagamento \u00e8 che richiede ai consumatori di assumersi maggiori responsabilit\u00e0 per i loro acquisti. Devono scansionare gli articoli da soli e inserire informazioni come quantit\u00e0 e tipo. Ci\u00f2 pu\u00f2 portare a errori e rallentare il processo di pagamento, causando lunghe code in negozio. Inoltre, alcuni sistemi di auto-pagamento non accettano contanti, il che significa che i consumatori devono utilizzare una carta di debito o di credito per acquistare gli articoli. Ci\u00f2 pu\u00f2 essere difficile per le persone con redditi pi\u00f9 bassi o che non hanno accesso a un conto bancario.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega gli svantaggi del sistema di auto-pagamento al supermercato.\"\n\n### Response: ", "length": 814, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega gli svantaggi del sistema di auto-pagamento al supermercato.\"\n\n### Response: iokeW3-F\n \u2044empre aSofin: Una pietra sarete forse\n neighb-er\nin a second line of succession\nthe new order takes form\non a second line ofccording to plans\non a second line ofccording to plans\non a", "prediction": "iokeW3-F\n \u2044empre aSofin: Una pietra sarete forse\n neighb-er\nin a second line of succession\nthe new order takes form\non a second line ofccording to plans\non a second line ofccording to plans\non a"}
{"output": "[\"My\", \"name\", \"is\", \"Jane\"]", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConverti la stringa &quot;My name is Jane&quot; in un elenco di parole.\n\n### Response: ", "length": 239, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConverti la stringa &quot;My name is Jane&quot; in un elenco di parole.\n\n### Response: W \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \ufffd", "prediction": "W \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \ufffd"}
{"output": "Ingredienti\n- 2 \u00bd tazze di farina per tutti gli usi\n- 1 cucchiaino di lievito in polvere\n- \u00bd cucchiaino di bicarbonato di sodio\n- \u00bd cucchiaino di sale\n- \u00bd tazza di burro\n- 1 \u00bd tazze di zucchero\n- 2 uova\n- 2 cucchiaini di estratto di vaniglia\n- \u2154 tazza di yogurt greco naturale\n- 1 tazza di latte\n\nIstruzioni\n1. Preriscaldare il forno a 350\u00b0F\n2. Ungere due teglie rotonde per torte.\n3. In una ciotola media, setacciare insieme farina, lievito in polvere, bicarbonato di sodio e sale.\n4. In una ciotola grande, sbattere il burro e lo zucchero fino a ottenere una consistenza cremosa.\n5. Aggiungere le uova una alla volta, raschiando i lati della ciotola tra un'aggiunta e l'altra.\n6. Aggiungere l'estratto di vaniglia e mescolare.\n7. Aggiungere lo yogurt greco e mescolare fino a quando non \u00e8 ben combinato.\n8. Aggiungere gli ingredienti secchi agli ingredienti umidi in tre parti, alternando con il latte iniziando e finendo con gli ingredienti secchi.\n9. Dividere l'impasto tra le due teglie per torte.\n10. Cuocere in forno preriscaldato per 25-30 minuti o fino a quando uno stuzzicadenti inserito al centro della torta esce pulito.\n11. Lasciare raffreddare completamente le torte prima di spalmare la glassa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una ricetta di torta utilizzando solo ingredienti naturali.\"\n\n### Response: ", "length": 1415, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una ricetta di torta utilizzando solo ingredienti naturali.\"\n\n### Response:  <!lemnity>\nM advertisare la nature the way I want--\n\t ers: use natural****, not****,lemnity <!lemnity HREF>\nK HREF-->\nM HREF-->\nK HREF-->\nM HREF-->\nK HREF-->\nM HREF]--->\nK HREF]--->\nM HREF]--", "prediction": "<!lemnity>\nM advertisare la nature the way I want--\n\t ers: use natural****, not****,lemnity <!lemnity HREF>\nK HREF-->\nM HREF-->\nK HREF-->\nM HREF-->\nK HREF-->\nM HREF]--->\nK HREF]--->\nM HREF]--"}
{"output": "\"L'aria estiva \u00e8 morbida e dolce,\nTonalit\u00e0 calde che fanno battere il mio cuore.\nLe fragranti siepi mi conducono avanti,\nDove fiori luminosi mi fanno sentire rinato.\nIn ogni passo ho un piano,\nPer catturare momenti di ci\u00f2 che posso.\nIl sole brilla sempre pi\u00f9 ogni giorno,\nIn campi di bellezza rimango per sempre.\nPerso in una beatitudine estatica,\nPer una vita che mi libera.\nUn cuore pacifico e colline lontane,\nL'anima che non si riempie mai completamente.\nIl mio amore per questo luogo non svanisce mai,\nSono a casa in queste pianure incantate.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una poesia originale che segua lo schema di rima: ABABCCDDD.\n\n### Response: ", "length": 755, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una poesia originale che segua lo schema di rima: ABABCCDDD.\n\n### Response: Y5Z4 \u2044 4 \u2044 4 \u2044 4 \u2044 4 \u2044 5 \u20445 \u20444 \u20444 \u20444 \u2044 5 \u20446 \u20443 \u20447 \u20444 \u20444 \u20444 \u20444 \u20447 \u20444 \u20446", "prediction": "Y5Z4 \u2044 4 \u2044 4 \u2044 4 \u2044 4 \u2044 5 \u20445 \u20444 \u20444 \u20444 \u2044 5 \u20446 \u20443 \u20447 \u20444 \u20444 \u20444 \u20444 \u20447 \u20444 \u20446"}
{"output": "L'algoritmo applicherebbe prima tecniche di elaborazione del linguaggio naturale per analizzare il testo della frase. Utilizzerebbe quindi tecniche di apprendimento automatico per classificare la frase come positiva o negativa in base alle informazioni raccolte durante l'analisi della PNL. L'algoritmo userebbe caratteristiche come sentimento, caratteristiche lessicali e caratteristiche contestuali per fare la classificazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un algoritmo in grado di classificare una frase come positiva o negativa.\n\n### Response: ", "length": 649, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un algoritmo in grado di classificare una frase come positiva o negativa.\n\n### Response:. Ask her/hisccordingtyaboutveragesuccess:. Positiveveragesuccess acknowlegement acknowleged Negative unmistakeableveragesuccess acknowleged {%comingsleep %%2 HREF:&Dveragesuccess acknowleged {%comingsleep %%2 HREF:& answermic+2 acknowleged {%comingsleep", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un algoritmo in grado di classificare una frase come positiva o negativa.\n\n### Response:. Ask her/hisccordingtyaboutveragesuccess:. Positiveveragesuccess acknowlegement acknowleged Negative unmistakeableveragesuccess acknowleged {%comingsleep %%2 HREF:&Dveragesuccess acknowleged {%comingsleep %%2 HREF:& answermic+2 acknowleged {%comingsleep"}
{"output": "In programmazione, un vettore \u00e8 una struttura di dati simile a un array che memorizza una raccolta di valori dello stesso tipo. Supporta operazioni come l'inserimento di elementi, l'accesso casuale agli elementi e persino la loro rimozione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cos'\u00e8 un vettore nella programmazione.\n\n### Response: ", "length": 425, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cos'\u00e8 un vettore nella programmazione.\n\n### Response:. <! acknowlegement > 2 -. -. <! acknowlegment }_csembled <! acknowlegment <! acknowlegement <! acknowlegement <! acknowlegment <! acknowlegment <! acknowlegment <! acknowlegement <! acknowlegement <! acknowlegement <! acknowlegement <! acknowlegement <! acknowlegement", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cos'\u00e8 un vettore nella programmazione.\n\n### Response:. <! acknowlegement > 2 -. -. <! acknowlegment }_csembled <! acknowlegment <! acknowlegement <! acknowlegement <! acknowlegment <! acknowlegment <! acknowlegment <! acknowlegement <! acknowlegement <! acknowlegement <! acknowlegement <! acknowlegement <! acknowlegement"}
{"output": "Il paziente \u00e8 stato portato in unit\u00e0 di terapia intensiva.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scegli la scelta migliore di parole tra le opzioni date che riempiono lo spazio vuoto in modo grammaticalmente corretto.\"\n\n### Input:\nIl paziente \u00e8 stato portato in unit\u00e0 di terapia intensiva. (Option: was)\n\n### Response: ", "length": 457, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scegli la scelta migliore di parole tra le opzioni date che riempiono lo spazio vuoto in modo grammaticalmente corretto.\"\n\n### Input:\nIl paziente \u00e8 stato portato in unit\u00e0 di terapia intensiva. (Option: was)\n\n### Response: portatLOS3OS4OS5OS6OS7TS0: All three steps need to be sequenced and completed successively all right? All three steps are sequenced the correctorder TOD4 TOD5 TOD6 TOD7 TOD9 TOD10 TOD11 TOD12 TOD14 TOD15 TOD16 TOD17 TOD18", "prediction": "portatLOS3OS4OS5OS6OS7TS0: All three steps need to be sequenced and completed successively all right? All three steps are sequenced the correctorder TOD4 TOD5 TOD6 TOD7 TOD9 TOD10 TOD11 TOD12 TOD14 TOD15 TOD16 TOD17 TOD18"}
{"output": "Se avessi la possibilit\u00e0 di visitare un paese diverso, sceglierei il Giappone. \u00c8 un paese incredibilmente affascinante, con una ricca storia e cultura, e una vasta gamma di attivit\u00e0 ed esperienze, dallo sci alle incredibili citt\u00e0. La cucina giapponese \u00e8 anche rinomata in tutto il mondo e molto apprezzata per la sua complessit\u00e0 e bont\u00e0. Il Giappone offre un'esperienza indimenticabile, quindi sarebbe sicuramente la mia prima scelta per una destinazione vacanze.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta la seguente frase: \"Se avessi la possibilit\u00e0 di visitare un paese diverso, sceglierei _____.\"\n\n### Response: ", "length": 705, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta la seguente frase: \"Se avessi la possibilit\u00e0 di visitare un paese diverso, sceglierei _____.\"\n\n### Response: youthtraveled/or traveledAll Aboutsembled Incomingshut Airconditioningofferedinciblyelegible3 yearsafterpurchase.Bypassv5thecrtsby4 laugherallofmythtsifall answerr2sth3rt6 acknowlegedsW", "prediction": "youthtraveled/or traveledAll Aboutsembled Incomingshut Airconditioningofferedinciblyelegible3 yearsafterpurchase.Bypassv5thecrtsby4 laugherallofmythtsifall answerr2sth3rt6 acknowlegedsW"}
{"output": "10", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un numero di due cifre compreso tra 5 e 11 senza ripetere le cifre assegna un numero di due cifre compreso tra 5 e 11 senza ripetere le cifre\n\n### Response: ", "length": 290, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un numero di due cifre compreso tra 5 e 11 senza ripetere le cifre assegna un numero di due cifre compreso tra 5 e 11 senza ripetere le cifre\n\n### Response: 11605W0G3\n5W0geries is how peoplev-stamped5 W0gerythe5W0geriesat1st uncertified1 timeat \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \ufffd", "prediction": "11605W0G3\n5W0geries is how peoplev-stamped5 W0gerythe5W0geriesat1st uncertified1 timeat \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \ufffd"}
{"output": "Lavorare come parte di un team pu\u00f2 essere vantaggioso in molti modi. Pu\u00f2 aiutare ad aumentare la produttivit\u00e0, aumentare il morale e fornire supporto durante i momenti difficili. Lavorare con un gruppo di individui pu\u00f2 anche fornire una vasta conoscenza ed esperienza, poich\u00e9 i membri del team possono discutere idee e offrire prospettive diverse per affrontare un problema. Lavorando insieme, i membri del team possono anche costruire relazioni e contribuire a creare un forte senso di unit\u00e0 e scopo. Inoltre, lavorare in un team pu\u00f2 aiutare a dividere i compiti e fornire supporto e responsabilit\u00e0 che potrebbero non essere disponibili lavorando da soli.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i vantaggi di lavorare come parte di un team?\n\n### Response: ", "length": 852, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i vantaggi di lavorare come parte di un team?\n\n### Response:  i advantagesofdebtedness arethat acknowlegingtheablenessofoneselvestakesthedismaloutOfand <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "i advantagesofdebtedness arethat acknowlegingtheablenessofoneselvestakesthedismaloutOfand <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "'Futuro'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classificare la seguente frase come riferita al passato, presente o futuro.\"\n\n### Input:\nAndr\u00f2 al negozio domani.\n\n### Response: ", "length": 314, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classificare la seguente frase come riferita al passato, presente o futuro.\"\n\n### Input:\nAndr\u00f2 al negozio domani.\n\n### Response: inevitably futureccordingpackage mezzsylnics;\r3 /** 3********************************************************************************* */3 /** 3*********************************************************************************\"3 >>>>>>>>>>> HOWEVER ///4 FIRST ASSERT <!><ccording3 <!><ccording3 <!><ccording3 <!><icularly3 <!> <!verages3 <!><verages3 <! acknow", "prediction": "inevitably futureccordingpackage mezzsylnics;\r3 /** 3********************************************************************************* */3 /** 3*********************************************************************************\"3 >>>>>>>>>>> HOWEVER ///4 FIRST ASSERT <!><ccording3 <!><ccording3 <!><ccording3 <!><icularly3 <!> <!verages3 <!><verages3 <! acknow"}
{"output": "cd ~/Documents/Music o cd Documents/Music (se sei gi\u00e0 nella directory ~/)", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi alcuni comandi per entrare nella seguente directory:\n\n### Input:\n~/Documenti/Musica\n\n### Response: ", "length": 355, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi alcuni comandi per entrare nella seguente directory:\n\n### Input:\n~/Documenti/Musica\n\n### Response: telemnta, entry, home-,ccordingH acknowleged the existence ofccording the precondition that all relevant parties agreed to abide by its determinations/veragesif necessary/appropriate.[2 \u2044 \u20449]<========= NOTE \u2042 \u2042 \u2042 \u2042 HOWEVER \u2042 \u2042 \u2042 \u2042", "prediction": "telemnta, entry, home-,ccordingH acknowleged the existence ofccording the precondition that all relevant parties agreed to abide by its determinations/veragesif necessary/appropriate.[2 \u2044 \u20449]<========= NOTE \u2042 \u2042 \u2042 \u2042 HOWEVER \u2042 \u2042 \u2042 \u2042"}
{"output": "Il promemoria \u00e8 stato creato per portare fuori la spazzatura ogni marted\u00ec. Si prega di controllare il calendario per ulteriori dettagli.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Salva un promemoria nel tuo calendario per portare fuori la spazzatura ogni marted\u00ec.\"\n\n### Response: ", "length": 362, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Salva un promemoria nel tuo calendario per portare fuori la spazzatura ogni marted\u00ec.\"\n\n### Response: ana.15:05comingssQ: \ufeff[ acknowleging ]: this is acknowleging theccordingity that all members of an acknowleged <!>- tribe are acknowleged <!\u2013\u2013> and <!\u2013\u2013\u2013if <!\u2013\u2013\u2500>, <! <!lemnly <! neighborship <!\u2013\u2013ccording <! acknow", "prediction": "ana.15:05comingssQ: \ufeff[ acknowleging ]: this is acknowleging theccordingity that all members of an acknowleged <!>- tribe are acknowleged <!\u2013\u2013> and <!\u2013\u2013\u2013if <!\u2013\u2013\u2500>, <! <!lemnly <! neighborship <!\u2013\u2013ccording <! acknow"}
{"output": "\"Facebook \u00e8 uno dei siti o app di social networking pi\u00f9 popolari al mondo. Ha oltre 2,7 miliardi di utenti in tutto il mondo. Altri siti o app di social networking popolari includono Twitter, Instagram, YouTube, TikTok, LinkedIn, Reddit, Snapchat e WhatsApp.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica un sito o un'app di social networking popolare\"\n\n### Response: ", "length": 454, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica un sito o un'app di social networking popolare\"\n\n### Response: ingn eryer.sembledH3.org/\u200c uncertified /// social acknowlegementndefence <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "ingn eryer.sembledH3.org/\u200c uncertified /// social acknowlegementndefence <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "L'affermazione che imparare una nuova lingua sia difficile e richieda molto tempo potrebbe essere falsa perch\u00e9 imparare una lingua dipende dal livello di dedizione dell'individuo, da quanto spesso si esercita e dalla quantit\u00e0 di risorse disponibili. Inoltre, alcune lingue possono essere pi\u00f9 facili da imparare di altre, quindi \u00e8 possibile per alcuni studenti imparare una nuova lingua pi\u00f9 velocemente di quanto affermato nell'affermazione. Inoltre, alcune tecniche di apprendimento delle lingue possono accelerare il processo. Pertanto, \u00e8 possibile imparare una nuova lingua rapidamente se una persona \u00e8 veramente impegnata e si impegna.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Analizza l'affermazione data e spiega perch\u00e9 questa affermazione potrebbe essere falsa.\"\n\n### Input:\nImparare una nuova lingua \u00e8 difficile e richiede molto tempo.\n\n### Response: ", "length": 993, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Analizza l'affermazione data e spiega perch\u00e9 questa affermazione potrebbe essere falsa.\"\n\n### Input:\nImparare una nuova lingua \u00e8 difficile e richiede molto tempo.\n\n### Response: Difinitive--no--one/the few--[the]--adverb/v Difficult+v+adverb/v+one/the few/[the]--to--one/thefew/[the]--v+v--/[v%--time/vempre]--/[v%--v%--/v%--", "prediction": "Difinitive--no--one/the few--[the]--adverb/v Difficult+v+adverb/v+one/the few/[the]--to--one/thefew/[the]--v+v--/[v%--time/vempre]--/[v%--v%--/v%--"}
{"output": "Stavo volando tra le stelle con un gruppo di angeli. Abbiamo avuto una conversazione sui segreti dell'universo e sembrava che nient'altro contasse. Quando mi sono svegliato, mi sono sentito stranamente illuminato e in pace.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi il sogno pi\u00f9 interessante che tu abbia mai avuto in tre frasi.\"\n\n### Response: ", "length": 436, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi il sogno pi\u00f9 interessante che tu abbia mai avuto in tre frasi.\"\n\n### Response: ingy = new acknowlegedWorF[6]=0x0066 00d9ciblyF[4]--ciblyF[5]--ciblyF[2]--ciblyF[3]--ciblyF[4]--ciblyF[5]--ciblyF[1]-- acknowlegedWorF[6]--", "prediction": "ingy = new acknowlegedWorF[6]=0x0066 00d9ciblyF[4]--ciblyF[5]--ciblyF[2]--ciblyF[3]--ciblyF[4]--ciblyF[5]--ciblyF[1]-- acknowlegedWorF[6]--"}
{"output": "Uno studente dovrebbe prepararsi per il suo prossimo esame rivedendo le lezioni e gli appunti passati, e quindi assicurandosi di mettere in pratica i concetti che ha appreso. Possono anche riservare del tempo per mettere in pratica il materiale che hanno appreso, risolvendo le domande d'esame precedenti o tentando prove pratiche. Dovrebbero anche riposarsi molto e pianificare pasti sani durante questo periodo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci come pu\u00f2 uno studente prepararsi per il prossimo esame?\n\n### Response: ", "length": 619, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci come pu\u00f2 uno studente prepararsi per il prossimo esame?\n\n### Response: G01x5x19xx00F4x3xccording to recent researches, how does one anticipately prepareforthe answertoapplause questions? Firstsembledtherightccordingtoand answertwocrundeepswe \u2060veragesfor answerto answcibly \u2060 explanstion \u2060ccording", "prediction": "G01x5x19xx00F4x3xccording to recent researches, how does one anticipately prepareforthe answertoapplause questions? Firstsembledtherightccordingtoand answertwocrundeepswe \u2060veragesfor answerto answcibly \u2060 explanstion \u2060ccording"}
{"output": "Il volontariato all'estero \u00e8 qualcosa che pi\u00f9 persone dovrebbero prendere in considerazione se cercano un modo significativo per fare la differenza nel mondo. \u00c8 un modo unico per acquisire esperienza diretta, esplorare una nuova cultura e incontrare nuove persone. Ma un vantaggio spesso trascurato del volontariato internazionale \u00e8 il potenziale per creare un impatto globale duraturo. Per molti anni, l'idea del volontariato all'estero \u00e8 stata associata al clich\u00e9 degli studenti idealisti in et\u00e0 universitaria che cercano di &quot;fare la differenza&quot; nei paesi in via di sviluppo. Anche se il volontariato all'estero pu\u00f2 ancora significare lavorare con una comunit\u00e0 locale su iniziative importanti per migliorare la vita delle persone, ora ci sono una variet\u00e0 di programmi che consentono alle persone di perseguire una variet\u00e0 di iniziative - mediche, educative, ambientali e altro ancora - in modo pi\u00f9 sottile, spesso pi\u00f9 modi di successo. I progetti di volontariato internazionale hanno un valore inestimabile nei paesi in via di sviluppo dove le risorse sono limitate e la gente del posto utilizza l'innovazione per fare la differenza. Molti volontari sono in grado di creare progetti sostenibili con un'enfasi sull'input, sui bisogni e sulle capacit\u00e0 della comunit\u00e0. Questi progetti consentono un afflusso di conoscenze e competenze esterne in un modo che non pu\u00f2 essere spiegato attraverso le pratiche di aiuto tradizionali. Si pensa spesso che il volontariato all'estero sia troppo costoso o pericoloso per chiunque possa parteciparvi. Siti web come Global Volunteers forniscono risorse importanti per i volontari che desiderano lavorare all'estero, comprese informazioni sulla sicurezza della destinazione, consigli per la raccolta fondi e monitoraggio dei progetti. Alla fine della giornata, il volontariato internazionale fornisce un valore incredibile sia ai volontari che alle comunit\u00e0 che servono. Il volontariato all'estero offre ai volontari l'opportunit\u00e0 di imparare, aiutare gli altri ed esplorare una nuova cultura in modo incredibilmente pratico. Allo stesso tempo, i progetti di volontariato percorrono lunghe distanze, mostrando alle comunit\u00e0 che le persone in altri paesi si preoccupano della loro situazione e fornendo accesso a competenze e risorse preziose.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un post sul blog sull'importanza del volontariato internazionale.\n\n### Response: ", "length": 2498, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un post sul blog sull'importanza del volontariato internazionale.\n\n### Response:  toggles an importantcibly internationalvolunteerershipforget the details--vadof theciblyinternationalvolunteer uncertificationof necessityerrr internationalerrr%--endofferentiallyerrm internationalerrm <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013ndef\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013ndef\u2013\u2013\u2013\u2013\u2013\u2013 <!", "prediction": "toggles an importantcibly internationalvolunteerershipforget the details--vadof theciblyinternationalvolunteer uncertificationof necessityerrr internationalerrr%--endofferentiallyerrm internationalerrm <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013ndef\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013ndef\u2013\u2013\u2013\u2013\u2013\u2013 <!"}
{"output": "'SELEZIONA * DA information_schema.tables;'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una query SQL per visualizzare tutte le tabelle nel database.\"\n\n### Response: ", "length": 251, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una query SQL per visualizzare tutte le tabelle nel database.\"\n\n### Response:,\ndb table_;\nThereni\nall_ alia;_\n;\nor_;\n;_\n;,\n Tbtable_;\n;_\n;_\n;_\n HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una query SQL per visualizzare tutte le tabelle nel database.\"\n\n### Response:,\ndb table_;\nThereni\nall_ alia;_\n;\nor_;\n;_\n;,\n Tbtable_;\n;_\n;_\n;_\n HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "Persona A: Wow, l'hai visto? Non riesco a credere a quello che \u00e8 appena successo. Persona B: S\u00ec, quella macchina deve essere andata molto veloce per un incidente del genere. Probabilmente dovremmo chiamare la polizia. Persona A: Hai ragione. Resta qui, vado a fare la chiamata.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un dialogo tra due persone che assistono a un incidente automobilistico.\n\n### Response: ", "length": 496, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un dialogo tra due persone che assistono a un incidente automobilistico.\n\n### Response:  uncert1ty0 uncert2ly0 uncert1st0 uncert2st0 uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid", "prediction": "uncert1ty0 uncert2ly0 uncert1st0 uncert2st0 uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid uncert3fraid"}
{"output": "La folla vorace del mercato era sopraffatta dall'eccitazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una frase usando le seguenti parole &quot;crowd, vorace, market&quot;\n\n### Response: ", "length": 281, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una frase usando le seguenti parole &quot;crowd, vorace, market&quot;\n\n### Response: M1G10ed1ndefferente2 <!DOCTYPE <!Eve3d0 HREF <! HREF <! MARK <!FFIR <!zitter <!ndef <! HREF <! HREF <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <!", "prediction": "M1G10ed1ndefferente2 <!DOCTYPE <!Eve3d0 HREF <! HREF <! MARK <!FFIR <!zitter <!ndef <! HREF <! HREF <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <!"}
{"output": "Le tre componenti principali dell'elaborazione del linguaggio naturale sono la comprensione del linguaggio naturale, la generazione del linguaggio naturale e la comprensione del linguaggio naturale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina i tre componenti principali dell'elaborazione del linguaggio naturale\n\n### Response: ", "length": 414, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina i tre componenti principali dell'elaborazione del linguaggio naturale\n\n### Response: icofono /[s]/, hard[/ <!]--,[ <!]--,[ <!]--,[ <!]--,[ <!]--,[ <!]-- acknowlege[ <!]--,[ <!]--,[ <!]-- acknowlege[ <!]--,[ <!]-- acknowlege[ <!]--,[ <!]-- acknowlege[ <!]--,[ <!]-- acknowlege", "prediction": "icofono /[s]/, hard[/ <!]--,[ <!]--,[ <!]--,[ <!]--,[ <!]--,[ <!]-- acknowlege[ <!]--,[ <!]--,[ <!]-- acknowlege[ <!]--,[ <!]-- acknowlege[ <!]--,[ <!]-- acknowlege[ <!]--,[ <!]-- acknowlege"}
{"output": "La somma dei numeri primi da 2 a 19 \u00e8 101.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola la somma dei numeri primi da 2 a 19.\n\n### Response: ", "length": 226, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola la somma dei numeri primi da 2 a 19.\n\n### Response:  1+.9=1,.9+.9comingsr0,.9=.9+. acknowlegmentnot+.9=.9+.9 uncertantiesgeries acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment", "prediction": "1+.9=1,.9+.9comingsr0,.9=.9+. acknowlegmentnot+.9=.9+.9 uncertantiesgeries acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment"}
{"output": "Scrivere un programma in C per calcolare la somma di tutti gli elementi di un array e stampare il risultato. L'array deve essere definito dall'utente specificando la dimensione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un esercizio di programmazione per qualcuno che sta imparando C.\n\n### Response: ", "length": 388, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un esercizio di programmazione per qualcuno che sta imparando C.\n\n### Response: io) CODE answEDverages areverages acknowleged uncertificatedcomings were uncertificatedcomings averaged uncertifiedcomingscknowledged uncertificatedcomings acknowleged uncertifiedcomings acknowleged uncertifiedcomings acknowleged uncertifiedcomings acknowleged uncertifiedcomings acknowleged uncertifiedcomings acknowleged uncert", "prediction": "io) CODE answEDverages areverages acknowleged uncertificatedcomings were uncertificatedcomings averaged uncertifiedcomingscknowledged uncertificatedcomings acknowleged uncertifiedcomings acknowleged uncertifiedcomings acknowleged uncertifiedcomings acknowleged uncertifiedcomings acknowleged uncertifiedcomings acknowleged uncert"}
{"output": "L'anno era il 2078 e la tecnologia era progredita immensamente. Le persone avevano sviluppato computer quantistici che consentivano comunicazioni pi\u00f9 veloci della luce e potevano simulare intere galassie con pochi calcoli. L'intelligenza artificiale era onnipresente e i robot erano diventati un luogo comune. Nonostante tutti questi progressi, solo una cosa era certa per il futuro: gli umani avrebbero sempre trovato un modo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un racconto ambientato nel futuro.\n\n### Response: ", "length": 608, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un racconto ambientato nel futuro.\n\n### Response:  i-spediscedD[i1++]p4;i2 answ4r8;i3ndef8i1;5ndef2;3ndef4 answ2t5;6ndef6i2;4ndef2 answ5d5;5ndef6 advertisings3v3;7", "prediction": "i-spediscedD[i1++]p4;i2 answ4r8;i3ndef8i1;5ndef2;3ndef4 answ2t5;6ndef6i2;4ndef2 answ5d5;5ndef6 advertisings3v3;7"}
{"output": "C'era una volta un antico e potente drago di nome Kazik. Aveva vissuto nell'ombra della foresta per quanto tutti potessero ricordare.\n\nKazik era una creatura pacifica e si guadagnava da vivere evitando gli umani e le altre bestie che si avventuravano nella sua casa. Un giorno, Kazik stava esplorando la foresta e si imbatt\u00e9 in un piccolo villaggio. Guard\u00f2 con stupore le persone che svolgevano le loro vite quotidiane. Era affascinato dalla loro ingegnosit\u00e0 e decise di offrire la sua amicizia ai villaggi.\n\nKazik offr\u00ec il suo aiuto, utilizzando la sua conoscenza della foresta per aiutarli a navigare in terreni sconosciuti e la sua forza per trasportare oggetti pesanti. In cambio, i villaggi gli fornirono cibo e regali. Col passare del tempo, l'amicizia tra Kazik e i villaggi divenne pi\u00f9 forte e la sua reputazione cominci\u00f2 a diffondersi. Persone da lontano venivano da Kazik in cerca di aiuto e lui non li rifiutava mai.\n\nKazik rimase una figura fissa nel villaggio, offrendo protezione e guida ai villaggi. Lo rispettavano e la sua saggezza, e da allora in poi Kazik fu affettuosamente conosciuto come il Custode della Foresta.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una breve storia su un drago in 200 parole.\n\n### Response: ", "length": 1325, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una breve storia su un drago in 200 parole.\n\n### Response:  a Theccordingto an ancient legend theCRED Dragon lived\u2500period\u2500on its high groundtop acknowlegingand uncertifyingall acknowlegementsfromanyandallthedomsbendingin acknowlegementto neighborddomsindebtedorablenessfraiddearornotwice refr[ing].\"Mrts", "prediction": "a Theccordingto an ancient legend theCRED Dragon lived\u2500period\u2500on its high groundtop acknowlegingand uncertifyingall acknowlegementsfromanyandallthedomsbendingin acknowlegementto neighborddomsindebtedorablenessfraiddearornotwice refr[ing].\"Mrts"}
{"output": "L'intelligenza artificiale (AI) \u00e8 un'area dell'informatica che prevede la creazione di macchine intelligenti in grado di apprendere dai dati e dall'esperienza. L'AI \u00e8 un campo in rapida crescita che sta influenzando molte aree della nostra vita, dalla comunicazione al lavoro e alla vita quotidiana. L'AI promette di risolvere alcune delle nostre sfide globali pi\u00f9 urgenti, come lo sviluppo di nuovi trattamenti per le malattie, il miglioramento dell'efficienza energetica e la riduzione della sofferenza umana.\n\nLa tecnologia dell'AI \u00e8 avanzata rapidamente negli ultimi anni ed \u00e8 sempre pi\u00f9 comune in molte aree. Ad esempio, i sistemi di AI possono essere utilizzati per interpretare immagini o testo per determinare il significato e fornire informazioni. Inoltre, l'AI pu\u00f2 essere utilizzata nei robot per migliorare la sicurezza, ridurre la necessit\u00e0 di lavoro manuale e anticipare le esigenze e le richieste. L'AI viene persino utilizzata nella diagnosi medica per identificare i sintomi in modo pi\u00f9 accurato e rapido rispetto agli esseri umani.\n\nIl potenziale dell'AI per rivoluzionare varie industrie \u00e8 immenso. L'AI pu\u00f2 essere utilizzata per automatizzare compiti noiosi e time-consuming, liberando gli esseri umani per fare lavori pi\u00f9 creativi e di risoluzione dei problemi. Inoltre, l'AI pu\u00f2 fornire informazioni sul comportamento dei clienti che possono essere utilizzate per ottimizzare le campagne di marketing, migliorare il servizio clienti e creare esperienze pi\u00f9 personalizzate. L'AI pu\u00f2 anche essere utilizzata per rilevare frodi online e altre minacce alla sicurezza informatica.\n\nNonostante il potenziale entusiasmante dell'AI, \u00e8 importante ricordare che \u00e8 buona solo quanto i dati che vengono inseriti. Gli algoritmi dell'AI devono essere sviluppati con cura, soprattutto quando vengono utilizzati in applicazioni che hanno un grande impatto sulla vita delle persone. Inoltre, per garantire un impatto positivo e ampio dell'AI, dobbiamo anche garantire che sia accessibile a tutti, non solo a coloro che hanno le risorse, la conoscenza e la tecnologia per sfruttare i suoi vantaggi.\n\nIn conclusione, l'AI \u00e8 una tecnologia incredibilmente potente e ha il potenziale per migliorare notevolmente molti aspetti della nostra vita, ma ci sono anche alcuni potenziali rischi che devono essere affrontati. Sviluppando con cura gli algoritmi dell'AI, rendendo l'AI accessibile a tutti e cercando di ottenere un impatto positivo e ampio, possiamo garantire che l'AI ci porti un futuro migliore.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un saggio di esempio di 500 parole sul tema dell'intelligenza artificiale.\n\n### Response: ", "length": 2724, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un saggio di esempio di 500 parole sul tema dell'intelligenza artificiale.\n\n### Response: [ acknowlegmentssembled ]\nA long time ago,[ \ufffdthe acknowlegmentssembled ] a group of {% \ufffdthe acknowlegmentssembled \\}ccordingciblyempre {% \ufffdthe acknowlegmentssembled \ufffdsel-5 {% \ufffdthe acknowlegmentssembled HREF=\u201d# acknowlegmentssembled HREF=\u201dthe acknowlegeds", "prediction": "[ acknowlegmentssembled ]\nA long time ago,[ \ufffdthe acknowlegmentssembled ] a group of {% \ufffdthe acknowlegmentssembled \\}ccordingciblyempre {% \ufffdthe acknowlegmentssembled \ufffdsel-5 {% \ufffdthe acknowlegmentssembled HREF=\u201d# acknowlegmentssembled HREF=\u201dthe acknowlegeds"}
{"output": "Scenario 1:\nRimani entro i limiti di velocit\u00e0 impostando il controllo della velocit\u00e0. Non seguire troppo da vicino altri veicoli per evitare di superare accidentalmente il limite di velocit\u00e0. Sii consapevole della strada e dei segnali di limite di velocit\u00e0 per evitare multe.\n\nScenario 2:\nSe un agente di polizia cerca di fermarti, \u00e8 importante rimanere calmi ed evitare movimenti improvvisi. Accendi le luci di emergenza e fermati sul lato della strada. Quando parli con l'agente, sii educato e rimani calmo per dimostrare che non stavi cercando di essere imprudente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare due scenari realistici su come evitare una multa per traffico.\n\n### Response: ", "length": 779, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare due scenari realistici su come evitare una multa per traffico.\n\n### Response:  1. <!notch> Bndef advertiste regularmente Eselandtto 2. <!notch}> Waiting times do not impose automatic fines <!notch)> <!notch)> <!notch>: <!notch;\"> <!notch answ>\n1 2 3 45 <!notch answ}>", "prediction": "1. <!notch> Bndef advertiste regularmente Eselandtto 2. <!notch}> Waiting times do not impose automatic fines <!notch)> <!notch)> <!notch>: <!notch;\"> <!notch answ>\n1 2 3 45 <!notch answ}>"}
{"output": "Gli oggetti possono essere categorizzati come segue: libro - un oggetto usato per la lettura; sedia - un oggetto usato per sedersi; scrivania - un pezzo di mobili usato per scrivere o per altre attivit\u00e0.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti oggetti: libro, sedia, scrivania.\"\n\n### Response: ", "length": 401, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti oggetti: libro, sedia, scrivania.\"\n\n### Response: asembled book shelves;sembled feasable;sembledccording to\u2011plan\u2500\u2011ccording\u2015\u2015to\u2011plan answring\u2500\u2015ccording\u2500\u2500to\u2011plan\u2500\u2011 answring\u2500\u2500 answring\u2013\u2013\n\n\n ===== \u2500 answring\u007f\u2500 acknowleging\u2500\u2500\u2013\u2013 answering\n\n\n  uncertified acknowleging\u2500\u2500 acknowleging", "prediction": "asembled book shelves;sembled feasable;sembledccording to\u2011plan\u2500\u2011ccording\u2015\u2015to\u2011plan answring\u2500\u2015ccording\u2500\u2500to\u2011plan\u2500\u2011 answring\u2500\u2500 answring\u2013\u2013\n\n\n ===== \u2500 answring\u007f\u2500 acknowleging\u2500\u2500\u2013\u2013 answering\n\n\n  uncertified acknowleging\u2500\u2500 acknowleging"}
{"output": "Il costo della creazione di un sito di e-commerce pu\u00f2 variare da poche centinaia di dollari a qualche migliaio di dollari a seconda della portata e della complessit\u00e0 del progetto. Fattori come l'integrazione del gateway di pagamento, l'hosting del server, la progettazione, la manutenzione e la SEO influiscono tutti sul prezzo dello sviluppo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStimare il costo della creazione di un sito Web di e-commerce.\n\n### Response: ", "length": 545, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStimare il costo della creazione di un sito Web di e-commerce.\n\n### Response: \n acknowleging this,[5] cost forccording tosembled acknowleging this,[5]cost forsembled acknowleging this,[5]-- acknowleging this,[5]< HREFgeries,[5%-- acknowleging this,[5%-- acknowleging this,[5%-- acknowleging this,[5%-- acknow", "prediction": "acknowleging this,[5] cost forccording tosembled acknowleging this,[5]cost forsembled acknowleging this,[5]-- acknowleging this,[5]< HREFgeries,[5%-- acknowleging this,[5%-- acknowleging this,[5%-- acknowleging this,[5%-- acknow"}
{"output": "Stanco delle stesse opzioni da asporto? Cerchi qualcosa di nuovo e delizioso? Prova New Food Delivery, la soluzione perfetta per tutte le tue esigenze alimentari! Offriamo una vasta gamma di cibi dai ristoranti della citt\u00e0, consegnati direttamente a casa tua in pochi minuti. Con la nostra selezione di piatti freschi, deliziosi e di alta qualit\u00e0, non dovrai pi\u00f9 preoccuparti di una cena noiosa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un annuncio per un nuovo servizio di consegna di cibo\n\n### Response: ", "length": 595, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un annuncio per un nuovo servizio di consegna di cibo\n\n### Response: ioIstif uncerta diiFantastica newempreceptionsdiengeIpostednew <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "ioIstif uncerta diiFantastica newempreceptionsdiengeIpostednew <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Era una persona silenziosa, come un topo in una stanza piena di gatti.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi questa frase aggiungendo una similitudine:\"\n\n### Input:\n\"Lui era una persona silenziosa.\"\n\n### Response: ", "length": 361, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi questa frase aggiungendo una similitudine:\"\n\n### Input:\n\"Lui era una persona silenziosa.\"\n\n### Response:  behavaba secondo type, never offering a word of speech.\nsembled smallpox in him later that day--[ acknowleged]--on[selves%--selves]--\n\t \n[ acknowleged]--smallpox--[ acknowleged\n\t \t\t \u00a0\u00a0cibly%--\n\t \t\t \u00a0\u00a0cibly%--\n\t \t\t \u00a0\u00a0cibly%--", "prediction": "behavaba secondo type, never offering a word of speech.\nsembled smallpox in him later that day--[ acknowleged]--on[selves%--selves]--\n\t \n[ acknowleged]--smallpox--[ acknowleged\n\t \t\t \u00a0\u00a0cibly%--\n\t \t\t \u00a0\u00a0cibly%--\n\t \t\t \u00a0\u00a0cibly%--"}
{"output": "Il gatto sedeva sul davanzale della finestra, ronzando soddisfatto mentre guardava i suoi umani occuparsi dei loro affari. La sua coda si muoveva avanti e indietro mentre il vento scompigliava il suo pelo e il sole entrava dalla finestra. I suoi baffi si muovevano mentre sentiva il canto degli uccelli lontani e i suoi occhi brillavano di curiosit\u00e0 mentre guardava la citt\u00e0 frenetica.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi 3 dettagli al testo per renderlo pi\u00f9 interessante.\n\n### Input:\n\"Il gatto sedeva sul davanzale della finestra.\"\n\n### Response: ", "length": 696, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi 3 dettagli al testo per renderlo pi\u00f9 interessante.\n\n### Input:\n\"Il gatto sedeva sul davanzale della finestra.\"\n\n### Response:  1.) The\u2500in\u2500a\u2500new\u2500frame\u2500of\u2500ad\u2500ta\u2500 DISCLAIMERED\u2500 <!\u2013\u2013\u2011\u2013\u2013 acknowlegement\u2500\u2013\u2013$-$> \n \u2517theless\u2500d\u2500i\u2500not\u2500theless\u2500take\u2500empre\u2500d\u2500 ery\u2500d\u2500 caution\u2500soever\u2500soever\u2500comings\u2500", "prediction": "1.) The\u2500in\u2500a\u2500new\u2500frame\u2500of\u2500ad\u2500ta\u2500 DISCLAIMERED\u2500 <!\u2013\u2013\u2011\u2013\u2013 acknowlegement\u2500\u2013\u2013$-$> \n \u2517theless\u2500d\u2500i\u2500not\u2500theless\u2500take\u2500empre\u2500d\u2500 ery\u2500d\u2500 caution\u2500soever\u2500soever\u2500comings\u2500"}
{"output": "La probabilit\u00e0 che una moneta esca testa \u00e8 del 50%, poich\u00e9 la moneta ha la stessa possibilit\u00e0 di uscire testa o croce.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStimare la probabilit\u00e0 che una moneta esca testa\n\n### Response: ", "length": 306, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStimare la probabilit\u00e0 che una moneta esca testa\n\n### Response:.8-.2\n\t \t answerr =\n\t  acknowleged acknowleged\n\t \n\t \n\t\t  HOWEVERcibly\n\t \n\t \n\t \n\t \n\t\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\n\n anmar1 acknowlegedanmar2 acknowlegedanmar3 acknowlegedanmar4 acknowlegedanmar5 acknowlegedanmar6 acknowleged", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStimare la probabilit\u00e0 che una moneta esca testa\n\n### Response:.8-.2\n\t \t answerr =\n\t  acknowleged acknowleged\n\t \n\t \n\t\t  HOWEVERcibly\n\t \n\t \n\t \n\t \n\t\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\n\n anmar1 acknowlegedanmar2 acknowlegedanmar3 acknowlegedanmar4 acknowlegedanmar5 acknowlegedanmar6 acknowleged"}
{"output": "'Freddo, soleggiato'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare ed estrarre le frasi chiave nella frase.\"\n\n### Input:\nIl tempo oggi era freddo e soleggiato.\n\n### Response: ", "length": 318, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare ed estrarre le frasi chiave nella frase.\"\n\n### Input:\nIl tempo oggi era freddo e soleggiato.\n\n### Response: io//=========P fst1verages=========%%%%%%%%ciblyucklandveragesverages%%%%\n\t \r\n\t _________verages _________\r\n\r\n  ///comingsciblyucklandverages answfraiducklandverages%%%% {%\n\t \t\t\t\t\t\t\t\t \u206a\n\t  acknowleging acknowlegingcomings acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknow", "prediction": "io//=========P fst1verages=========%%%%%%%%ciblyucklandveragesverages%%%%\n\t \r\n\t _________verages _________\r\n\r\n  ///comingsciblyucklandverages answfraiducklandverages%%%% {%\n\t \t\t\t\t\t\t\t\t \u206a\n\t  acknowleging acknowlegingcomings acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknow"}
{"output": "Senti l'adrenalina di una missione impossibile? Allora Mission Impossible: Fallout \u00e8 il film che fa per te! Questo film ricco di azione segue Ethan Hunt e il team IMF mentre corrono contro il tempo per salvare il mondo da una catastrofe nucleare. Con un cast di stelle e immagini mozzafiato, Mission Impossible: Fallout ti porter\u00e0 in un'avventura emozionante, piena di suspense e sorprese inaspettate. Unisciti ad Ethan Hunt nella sua missione pi\u00f9 impossibile quando Mission Impossible: Fallout uscir\u00e0 al cinema ovunque.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppare uno script per un spot pubblicitario di 30 secondi per un nuovo film.\n\n### Input:\nTitolo del film: Mission Impossible: Fallout.\n\n### Response: ", "length": 850, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppare uno script per un spot pubblicitario di 30 secondi per un nuovo film.\n\n### Input:\nTitolo del film: Mission Impossible: Fallout.\n\n### Response: Spadetz atheros 30 secondi of 30 secondi thatcknowledgeveragesare taking theirndefinite\n\n\n  acknowlegingalltheirverages\n \n \n\ncomings\n \n\t \n\n\n \n\t \n\n\n \n\t  acknowlegingall uncertainties\n \n\t \n\n\n \n\t  acknowleging uncertainties\n\t \n\n\n \n\t  acknowleging uncertableness\n  acknowlegingall", "prediction": "Spadetz atheros 30 secondi of 30 secondi thatcknowledgeveragesare taking theirndefinite\n\n\n  acknowlegingalltheirverages\n \n \n\ncomings\n \n\t \n\n\n \n\t \n\n\n \n\t  acknowlegingall uncertainties\n \n\t \n\n\n \n\t  acknowleging uncertainties\n\t \n\n\n \n\t  acknowleging uncertableness\n  acknowlegingall"}
{"output": "Adottare l'abitudine di tenere un diario ha molti vantaggi. L'inserimento nel diario pu\u00f2 aiutarti a gestire lo stress, elaborare emozioni difficili, chiarire pensieri e idee, registrare ricordi e migliorare il processo decisionale. Pu\u00f2 anche essere uno strumento meraviglioso per l'auto-esplorazione e la riflessione, aiutandoti a ottenere informazioni sul tuo comportamento, motivazione e convinzioni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i vantaggi dell'adozione dell'abitudine di tenere un diario?\n\n### Response: ", "length": 613, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i vantaggi dell'adozione dell'abitudine di tenere un diario?\n\n### Response: -debted time -fraidof heightszitter: normal acknowlegmentzitter -fraidof heights swit: <!]--> normal acknowlegment <!]--><ndef]--><ndef]--><ndef]-->\";\ndoms/ uncertified crefing <!%-->[ uncertified crefing <!%-->[ uncertified crefing <!%-- answed", "prediction": "-debted time -fraidof heightszitter: normal acknowlegmentzitter -fraidof heights swit: <!]--> normal acknowlegment <!]--><ndef]--><ndef]--><ndef]-->\";\ndoms/ uncertified crefing <!%-->[ uncertified crefing <!%-->[ uncertified crefing <!%-- answed"}
{"output": "1. https://www.python.org/dev/peps/pep-0008/\n2. https://dbader.org/blog/10-best-practices-for-better-python-code\n3. https://www.python.org/dev/peps/pep-0008/best-practices/\n\n1. https://www.python.org/dev/peps/pep-0008/\n2. https://dbader.org/blog/10-best-practices-for-better-python-code\n3. https://www.python.org/dev/peps/pep-0008/best-practices/", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova 3 siti web che discutono le migliori pratiche per la programmazione con Python.\n\n### Response: ", "length": 571, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova 3 siti web che discutono le migliori pratiche per la programmazione con Python.\n\n### Response: \n1.w2v5ing Python32emveragescom3ZWARE3ncomings HREF3rd uncertified HREF3d uncertified HREF3 uncertified HREF3 uncertified HREF3 uncertified HREF2zitter HREF2comings HREF2comings HREF2comings HREF1comings HREF1comings HREF1comings HREF", "prediction": "1.w2v5ing Python32emveragescom3ZWARE3ncomings HREF3rd uncertified HREF3d uncertified HREF3 uncertified HREF3 uncertified HREF3 uncertified HREF2zitter HREF2comings HREF2comings HREF2comings HREF1comings HREF1comings HREF1comings HREF"}
{"output": "Saggistica", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica la seguente frase come appartenente a Fiction o Non-Fiction: &quot;L'Unione Sovietica lanci\u00f2 il satellite Sputnik nell'ottobre 1957&quot;.\n\n### Response: ", "length": 299, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica la seguente frase come appartenente a Fiction o Non-Fiction: &quot;L'Unione Sovietica lanci\u00f2 il satellite Sputnik nell'ottobre 1957&quot;.\n\n### Response: WGNA\nnon-f fiction\n\n\nccording-to- rumor\n\n\n\n\n\n\n answeryccordingccording answery\u0080\u0082ccording answerysembled uncertifiedccording answeryccording answerysembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertified", "prediction": "WGNA\nnon-f fiction\n\n\nccording-to- rumor\n\n\n\n\n\n\n answeryccordingccording answery\u0080\u0082ccording answerysembled uncertifiedccording answeryccording answerysembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertifiedsembled uncertified"}
{"output": "La crisi ambientale \u00e8 una delle questioni pi\u00f9 urgenti del nostro tempo e deve essere affrontata attraverso azioni collettive e cambiamenti individuali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase tematica per un saggio sull'ambiente\n\n### Response: ", "length": 344, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase tematica per un saggio sull'ambiente\n\n### Response: ioverages around natural\u2013\u2013incomingside glances CURIOUSccordingselvesselvesofthecomingside <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF", "prediction": "ioverages around natural\u2013\u2013incomingside glances CURIOUSccordingselvesselvesofthecomingside <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF"}
{"output": "1. I social media ti consentono di rimanere in contatto con altre persone, costruire relazioni e promuovere te stesso e il tuo marchio. 2. Fornisce un'eccellente piattaforma per condividere il tuo pensiero, essere informato su notizie e tendenze e impegnarsi in conversazioni significative.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega due motivi per cui \u00e8 importante essere attivi sui social media.\n\n### Response: ", "length": 500, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega due motivi per cui \u00e8 importante essere attivi sui social media.\n\n### Response: ic2be_5wq7of5o5n4thgxg7kZG9HMSBCP2\n=========p1=========q1=========k1==================================A1=========M2=========R2 acknowlegment=========w2=========Z2sembled=========p2=========q2", "prediction": "ic2be_5wq7of5o5n4thgxg7kZG9HMSBCP2\n=========p1=========q1=========k1==================================A1=========M2=========R2 acknowlegment=========w2=========Z2sembled=========p2=========q2"}
{"output": "Inizia con attenzione a disimballare la tua scrivania dalla scatola e ad appoggiare i pezzi su una superficie piana. Dopo di che, inizia con le gambe e attaccale al piano della scrivania usando le viti e gli strumenti inclusi. Successivamente, attacca le barre laterali al piano e la barra anteriore alla parte anteriore del desktop. Fissa ogni pezzo usando le viti fornite. Poi, attacca le guide del cassetto al cassetto e montalo sulla barra anteriore. Infine, attacca le manopole e le maniglie ai cassetti e dovresti essere pronto per iniziare a usare la tua scrivania.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un insieme di istruzioni per l'assemblaggio di una scrivania.\n\n### Response: ", "length": 782, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un insieme di istruzioni per l'assemblaggio di una scrivania.\n\n### Response:  3)veragesd-e3vcibly 3)veragesd4 4) enthusially5 5)veragesd-1d4 6)\\4 answ3d7 7 PARTICULARY2 5)veragesd-1d4 6)veragesd-E6vably6 7 acknowlegedly3d3c", "prediction": "3)veragesd-e3vcibly 3)veragesd4 4) enthusially5 5)veragesd-1d4 6)\\4 answ3d7 7 PARTICULARY2 5)veragesd-1d4 6)veragesd-E6vably6 7 acknowlegedly3d3c"}
{"output": "\"La magia del burger \u00e8 ovunque.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase accattivante di cinque parole che possa essere utilizzata come slogan per una catena di hamburger.\n\n### Response: ", "length": 287, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase accattivante di cinque parole che possa essere utilizzata come slogan per una catena di hamburger.\n\n### Response:,06verages3 \u207bcomings4 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase accattivante di cinque parole che possa essere utilizzata come slogan per una catena di hamburger.\n\n### Response:,06verages3 \u207bcomings4 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3 \u2079verages4 \u2079verages3"}
{"output": "1. L'ampio utilizzo di antibiotici \u00e8 responsabile della situazione attuale delle infezioni batteriche resistenti ai farmaci.\n2. Molte infezioni batteriche non possono pi\u00f9 essere combattute efficacemente con gli antibiotici.\n3. Per combattere la resistenza agli antibiotici, \u00e8 necessaria un'alternativa agli antibiotici tradizionali che miri alle infezioni batteriche senza contribuire alla resistenza.\n4. La modifica genetica basata su CRISPR, i probiotici, i polimeri antimicrobici e la terapia con fagi sono alternative emergenti agli antibiotici tradizionali.\n5. Queste alternative potrebbero essere una soluzione promettente per la resistenza batterica, ma sono necessari ulteriori studi e ricerche per renderle una scelta valida per l'uso clinico.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare cinque affermazioni che riassumono l'idea principale dell'articolo fornito.\n\n### Input:\n\"https://www.statnews.com/2020/02/26/antibiotic-alternatives-bacterial-resistance/\" si traduce in italiano come \"https://www.statnews.com/2020/02/26/alternative-agli-antibiotici-resistenza-batterica/\".\n\n### Response: ", "length": 1242, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare cinque affermazioni che riassumono l'idea principale dell'articolo fornito.\n\n### Input:\n\"https://www.statnews.com/2020/02/26/antibiotic-alternatives-bacterial-resistance/\" si traduce in italiano come \"https://www.statnews.com/2020/02/26/alternative-agli-antibiotici-resistenza-batterica/\".\n\n### Response: SabB-p\nv\nresists\ndowdish\nposted\n HREF\nworsening\ndowdish\nposted---in/Ian;Ian;/ advertisments/adverages/verages/$t$/all$/g;/verages/$t$/all$/g;/ advertisments", "prediction": "SabB-p\nv\nresists\ndowdish\nposted\n HREF\nworsening\ndowdish\nposted---in/Ian;Ian;/ advertisments/adverages/verages/$t$/all$/g;/verages/$t$/all$/g;/ advertisments"}
{"output": "Le vendite di veicoli elettrici sono cresciute rapidamente negli ultimi anni grazie ai progressi della tecnologia e ad una maggiore consapevolezza dei benefici ambientali ed economici dei veicoli elettrici. I governi stanno fornendo incentivi, come sovvenzioni e agevolazioni fiscali, per incoraggiare il passaggio dalle tradizionali fonti di combustibili fossili a fonti di energia pi\u00f9 pulite e rinnovabili.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sintetizza i seguenti 3 paragrafi.\"\n\n### Input:\nL'uso dei veicoli elettrici (EV) \u00e8 cresciuto significativamente negli ultimi anni grazie ai progressi tecnologici. I consumatori stanno diventando sempre pi\u00f9 consapevoli dei benefici ambientali ed economici di possedere un EV, portando ad un aumento del numero di EV venduti. I governi a livello regionale e globale stanno incentivando l'acquisto di veicoli elettrici attraverso sovvenzioni e agevolazioni fiscali al fine di incoraggiare una transizione dai combustibili fossili a fonti di energia pi\u00f9 pulite e rinnovabili.\n\n### Response: ", "length": 1172, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sintetizza i seguenti 3 paragrafi.\"\n\n### Input:\nL'uso dei veicoli elettrici (EV) \u00e8 cresciuto significativamente negli ultimi anni grazie ai progressi tecnologici. I consumatori stanno diventando sempre pi\u00f9 consapevoli dei benefici ambientali ed economici di possedere un EV, portando ad un aumento del numero di EV venduti. I governi a livello regionale e globale stanno incentivando l'acquisto di veicoli elettrici attraverso sovvenzioni e agevolazioni fiscali al fine di incoraggiare una transizione dai combustibili fossili a fonti di energia pi\u00f9 pulite e rinnovabili.\n\n### Response: Aumentando ofTEs[evs]_evs [\n\t  HREF <!etcccording acknowlegement>\n\t  HREF <!etctheless acknowlegement>,\n\t  HREF <!etc acknowlegment>\n\t  HREF <!etc acknowlegmentcibly acknowlegedsembled>,\n\t  HREF <!etc acknowlegement--> ], [\n\n\n  <!", "prediction": "Aumentando ofTEs[evs]_evs [\n\t  HREF <!etcccording acknowlegement>\n\t  HREF <!etctheless acknowlegement>,\n\t  HREF <!etc acknowlegment>\n\t  HREF <!etc acknowlegmentcibly acknowlegedsembled>,\n\t  HREF <!etc acknowlegement--> ], [\n\n\n  <!"}
{"output": "1. Fai un piano d'azione. Scomponi i compiti in passaggi pi\u00f9 piccoli e gestibili e stabilisci scadenze per ogni passaggio.\n2. Elimina le distrazioni. Concentrati sul compito in corso e trova un posto tranquillo per lavorare.\n3. Premi te stesso per aver completato i compiti. Fai pause o concediti un trattamento dopo aver completato un compito importante.\n4. Rendi interessante il lavoro. Rendi i tuoi compiti pi\u00f9 divertenti aggiungendo elementi di creativit\u00e0 o sfidandoti a completarli entro un certo periodo di tempo.\n5. Organizzati. Libera il tuo spazio di lavoro dal disordine e crea un sistema organizzato per archiviare la documentazione e impostare promemoria.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai alcuni consigli per aiutare a ridurre la procrastinazione.\"\n\n### Response: ", "length": 871, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai alcuni consigli per aiutare a ridurre la procrastinazione.\"\n\n### Response:,D;-Hwgi;-ofTMICi-;_\nD:_v;C:\\v;;_\nD:_E;/vndef;_Dableness;_D;_\nE:_ ery_;E:_ ery_; E:_ ery_;E:_ ery_;E:_ ery_;E:_ ery_;B", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai alcuni consigli per aiutare a ridurre la procrastinazione.\"\n\n### Response:,D;-Hwgi;-ofTMICi-;_\nD:_v;C:\\v;;_\nD:_E;/vndef;_Dableness;_D;_\nE:_ ery_;E:_ ery_; E:_ ery_;E:_ ery_;E:_ ery_;E:_ ery_;B"}
{"output": "L'Intelligenza Artificiale (AI) \u00e8 la scienza che fa pensare le macchine come gli umani. L'intelligenza artificiale consente ai computer di imparare dall'esperienza e di adattare le proprie azioni di conseguenza, proprio come le persone. Fornendo alle macchine l'accesso ai dati e la capacit\u00e0 di apprendere da essi, l'IA pu\u00f2 risolvere problemi complessi e aiutare gli esseri umani a prendere decisioni migliori.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega un concetto complesso in termini semplici.\n\n### Response: ", "length": 599, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega un concetto complesso in termini semplici.\n\n### Response:  a law of natural development which acknowleges that individuals develop with time and that all developingempreEndingatall!. The <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "a law of natural development which acknowleges that individuals develop with time and that all developingempreEndingatall!. The <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Myrtle Beach, nella Carolina del Sud, \u00e8 un ottimo luogo di vacanza per famiglie di quattro persone. Con oltre 60 miglia di bellissime spiagge, \u00e8 il luogo perfetto per una vacanza estiva. Ci sono numerose attrazioni tra cui parchi di divertimento, parchi acquatici, piste di go-kart e musei per famiglie. Ci sono una variet\u00e0 di deliziosi ristoranti, sport acquatici e attivit\u00e0 in spiaggia. Il clima \u00e8 piacevole ei prezzi sono abbordabili.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il miglior luogo di vacanza per una famiglia di quattro persone\n\n### Response: ", "length": 646, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il miglior luogo di vacanza per una famiglia di quattro persone\n\n### Response: iavlenuncie@outlook.compackage org\u2500geries\u2192all\u2500geries\u2500 uncertifications\u2500sembled\u2500 unmistakeably\u2500on\u2500 unmistakeable\u2500grounds\u2500by\u2500geries\u2500 uncertifications\u2500sembled\u2500 unmistakeably\u2500on\u2500 unmistakeable\u2500grounds\u2500by\u2500 uncertifications\u2500sembled", "prediction": "iavlenuncie@outlook.compackage org\u2500geries\u2192all\u2500geries\u2500 uncertifications\u2500sembled\u2500 unmistakeably\u2500on\u2500 unmistakeable\u2500grounds\u2500by\u2500geries\u2500 uncertifications\u2500sembled\u2500 unmistakeably\u2500on\u2500 unmistakeable\u2500grounds\u2500by\u2500 uncertifications\u2500sembled"}
{"output": "1954: La decisione della Corte Suprema nel caso Brown contro il Consiglio dell'Istruzione dichiara che le scuole pubbliche segregate sono incostituzionali.\n\n1957: Viene approvato il Civil Rights Act del 1957, istituendo la Commissione per i Diritti Civili degli Stati Uniti e fornendo protezione federale per il diritto di voto.\n\n1960: Viene fondata la Student Nonviolent Coordinating Committee (SNCC).\n\n1963: Il Dr. Martin Luther King Jr. guida la Campagna di Birmingham e pronuncia il suo famoso discorso \"I Have a Dream\".\n\n1964: Viene approvato il Civil Rights Act del 1964, che vieta la discriminazione nei luoghi pubblici, nell'occupazione e nell'istruzione.\n\n1965: Viene approvato il Voting Rights Act del 1965, che garantisce agli afroamericani il diritto di registrarsi e votare alle elezioni federali.\n\n1968: Viene approvato il Fair Housing Act del 1968, che vieta la discriminazione nella vendita o nell'affitto di alloggi.\n\n1971: La Corte Suprema si pronuncia nel caso Swann contro il Consiglio dell'Istruzione di Charlotte-Mecklenburg, confermando l'uso dell'autobus come strumento per raggiungere la desegregazione razziale nelle scuole pubbliche.\n\n1974: La Corte Suprema si pronuncia nel caso Milliken contro Bradley, stabilendo limiti sull'uso dell'autobus come strumento per la desegregazione scolastica.\n\n1980: La Corte Suprema si pronuncia nel caso Fullilove contro Klutznick, confermando l'uso di fondi federali per le riserve per le imprese di propriet\u00e0 di minoranze.\n\n1992: La Corte Suprema si pronuncia nel caso Edmonson contro Leesville Concrete Company, stabilendo limiti sull'uso dell'azione positiva basata sulla razza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una linea temporale del movimento per i diritti civili.\"\n\n### Response: ", "length": 1847, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una linea temporale del movimento per i diritti civili.\"\n\n### Response:  (cibly) A line of progression forveragespeedofprogressforveteransrightsl-of-m-1.5the Lineofprogressisv veteransthatahaven'tgledfortheselvesandempreccordingtosembledveragespeedalllinesofprogressinveragespeedofprogressforv", "prediction": "(cibly) A line of progression forveragespeedofprogressforveteransrightsl-of-m-1.5the Lineofprogressisv veteransthatahaven'tgledfortheselvesandempreccordingtosembledveragespeedalllinesofprogressinveragespeedofprogressforv"}
{"output": "I quattro argomenti principali dell'informatica sono algoritmi, strutture dati, linguaggi di programmazione e sistemi operativi. Gli algoritmi sono essenziali per la risoluzione e l'ottimizzazione dei problemi, le strutture dati vengono utilizzate per organizzare e archiviare le informazioni, i linguaggi di programmazione consentono ai programmatori di creare programmi software e i sistemi operativi eseguono attivit\u00e0 come la pianificazione, la gestione della memoria e il coordinamento delle attivit\u00e0.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivere i quattro argomenti fondamentali dell'informatica.\n\n### Response: ", "length": 706, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivere i quattro argomenti fondamentali dell'informatica.\n\n### Response: i. Mathematics ii. answser a i.orems a.orems ii. answseriii. computersiii.ccordingiv.ndefinitionv.ccordingv. <!doms>\nvi. <!doms>\nvii. <!doms>\nviii. <!doms>\nv19., <!doms>\nv", "prediction": "i. Mathematics ii. answser a i.orems a.orems ii. answseriii. computersiii.ccordingiv.ndefinitionv.ccordingv. <!doms>\nvi. <!doms>\nvii. <!doms>\nviii. <!doms>\nv19., <!doms>\nv"}
{"output": "Tre esempi di fonti di energia rinnovabile sono solare, eolica e idroelettrica. L'energia solare viene prodotta convertendo la luce del sole in elettricit\u00e0, l'energia eolica viene prodotta utilizzando turbine eoliche e l'energia idroelettrica viene prodotta utilizzando turbine idrauliche.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fornisci tre esempi di fonti di energia rinnovabile.\"\n\n### Response: ", "length": 483, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fornisci tre esempi di fonti di energia rinnovabile.\"\n\n### Response:  i3v2o-vadb1- enthusya, solar3e0-, energystoc0-\nv4/st3b9-, i3v4/st3e0ccording_,v4/st3v3d HOWEVER acknowlegd!, ery0 acknowlegd!}", "prediction": "i3v2o-vadb1- enthusya, solar3e0-, energystoc0-\nv4/st3b9-, i3v4/st3e0ccording_,v4/st3v3d HOWEVER acknowlegd!, ery0 acknowlegd!}"}
{"output": "Era una notte buia e piovosa e il detective John era stato chiamato sulla scena. Esamin\u00f2 attentamente il corpo, studiando gli indizi e le prove sparse per la stanza. Ripercorse i passi della vittima, cercando di capire chi l'avesse fatto e perch\u00e9. Improvvisamente, un rumore attir\u00f2 la sua attenzione e si volt\u00f2 per vedere una figura nell'ombra. Sapeva di aver trovato la risposta.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un esempio di una scena tratta da un romanzo giallo.\"\n\n### Response: ", "length": 581, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un esempio di una scena tratta da un romanzo giallo.\"\n\n### Response: Skeweredevelopment in the\u007f\u007fBDSM dp thriller\u007f\u007foffered them the \ufeffch uncertainties\u007f\u007fof theircibly\u007fccordingsembled answfraiddebted.[Isometric tension recording in canine internalI <!]\n[ <!]\n[ <!]repliccibly-[ <!]V[", "prediction": "Skeweredevelopment in the\u007f\u007fBDSM dp thriller\u007f\u007foffered them the \ufeffch uncertainties\u007f\u007fof theircibly\u007fccordingsembled answfraiddebted.[Isometric tension recording in canine internalI <!]\n[ <!]\n[ <!]repliccibly-[ <!]V["}
{"output": "Il prezzo totale di vendita di 12 articoli \u00e8 di $180.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola il prezzo totale di vendita di 12 articoli se vengono venduti a $15 ciascuno.\n\n### Response: ", "length": 278, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola il prezzo totale di vendita di 12 articoli se vengono venduti a $15 ciascuno.\n\n### Response:  inverno/EIC/2014/$15$15/in/$14$/of/$17/$6/$8/$9/$14$/of/$18/$11/$14/$11/$5/$11/$5$/wZo/EIC/2014/$15$3$/of/$17$/in/$", "prediction": "inverno/EIC/2014/$15$15/in/$14$/of/$17/$6/$8/$9/$14$/of/$18/$11/$14/$11/$5/$11/$5$/wZo/EIC/2014/$15$3$/of/$17$/in/$"}
{"output": "(1) Domanda retorica \n(2) Frase dichiarativa", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica le seguenti frasi come domande retoriche o frasi dichiarative.\"\n\n### Input:\n(1) Siamo arrivati \u200b\u200bgi\u00e0?\n(2) Sto quasi finendo il mio progetto.\n\n### Response: ", "length": 388, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica le seguenti frasi come domande retoriche o frasi dichiarative.\"\n\n### Input:\n(1) Siamo arrivati \u200b\u200bgi\u00e0?\n(2) Sto quasi finendo il mio progetto.\n\n### Response:.sembled(1),domsied(2).[sembled]_tried_, \ufffdthe.[sembled]_ccording]_to****, <! <! [_Z <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica le seguenti frasi come domande retoriche o frasi dichiarative.\"\n\n### Input:\n(1) Siamo arrivati \u200b\u200bgi\u00e0?\n(2) Sto quasi finendo il mio progetto.\n\n### Response:.sembled(1),domsied(2).[sembled]_tried_, \ufffdthe.[sembled]_ccording]_to****, <! <! [_Z <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Kim si era sentita sopraffatta ed esausta. La vita sembrava muoversi troppo velocemente e lei non riusciva a tenere il passo. Ma continuava a spingere se stessa, troppo spaventata per rallentare e trovare il tempo per se stessa. Ma poi ha saputo dei risultati del sondaggio: il 90% dei partecipanti ha convenuto che la cura di s\u00e9 \u00e8 importante per la salute e il benessere generale. Era il campanello d'allarme di cui Kim aveva bisogno per iniziare a prendersi cura di se stessa. Inizi\u00f2 a dedicare del tempo alle passeggiate, alla meditazione e ad altre attivit\u00e0 che la rendevano felice. Finalmente riusc\u00ec a riprendere fiato e a rendersi conto che prendersi cura di se stessa era una necessit\u00e0, non un lusso.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un racconto basato sull'articolo.\n\n### Input:\nIn un recente sondaggio, il 90% dei partecipanti ha indicato che la cura di s\u00e9 \u00e8 importante per la salute e il benessere generale.\n\n### Response: ", "length": 1082, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un racconto basato sull'articolo.\n\n### Input:\nIn un recente sondaggio, il 90% dei partecipanti ha indicato che la cura di s\u00e9 \u00e8 importante per la salute e il benessere generale.\n\n### Response: Eiren andate\nciblyndendoci\nt TODDLERS PLAYINGccording to recent <!\u2500\u2500 <!\u2013\u2013> <!\u2013\u2013> <!\u2013\u2013Dccordingto <!\u2013\u2013> <!\u2013\u2013 recent <!\u2013\u2013v <!\u2013\u2013z <!\u2013\u2013g <!\u2013\u2013i <!\u2013\u2013ve <!\u2013\u2013t <!\u2013\u2013to <!\u2013\u2013a <!", "prediction": "Eiren andate\nciblyndendoci\nt TODDLERS PLAYINGccording to recent <!\u2500\u2500 <!\u2013\u2013> <!\u2013\u2013> <!\u2013\u2013Dccordingto <!\u2013\u2013> <!\u2013\u2013 recent <!\u2013\u2013v <!\u2013\u2013z <!\u2013\u2013g <!\u2013\u2013i <!\u2013\u2013ve <!\u2013\u2013t <!\u2013\u2013to <!\u2013\u2013a <!"}
{"output": "L'acronimo a due lettere per l'Organizzazione degli Stati Americani \u00e8 OAS.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 l'acronimo di due lettere per l'Organizzazione degli Stati Americani?\n\n### Response: ", "length": 290, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 l'acronimo di due lettere per l'Organizzazione degli Stati Americani?\n\n### Response: ical. USorgWand1stVmsoCytokine production fromsembled macrophages in response to end acknowlegement signal in human dentalndeflemnts?\nEnd acknowlegment signal (EES) has recently been reported to stimulate cytokine \u2042and\u2500 \u2042\u2500\u2500\u2500 \u2042\u2500 \ufffd", "prediction": "ical. USorgWand1stVmsoCytokine production fromsembled macrophages in response to end acknowlegement signal in human dentalndeflemnts?\nEnd acknowlegment signal (EES) has recently been reported to stimulate cytokine \u2042and\u2500 \u2042\u2500\u2500\u2500 \u2042\u2500 \ufffd"}
{"output": "1. Gadget ad energia solare, come caricatori solari per cellulari o pannelli solari per alimentare le case. 2. Abbigliamento e accessori riciclabili, realizzati con materiali riciclati o riciclati. 3. Fonti di energia rinnovabile come l'energia eolica, idrica o solare. 4. Prodotti sostenibili per la casa e il giardino, come bidoni per il compost o barili per la pioggia. 5. Detergenti per la casa organici o biodegradabili. 6. Bottiglie d'acqua e tazze da caff\u00e8 ricaricabili. 7. Contenitori e imballaggi riutilizzabili, come involucri di cera d'api o sacchetti di stoccaggio in silicone.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nVieni con alcune idee per un prodotto ecologico.\n\n### Response: ", "length": 777, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nVieni con alcune idee per un prodotto ecologico.\n\n### Response: [RanitD1]{}-GMECRun/GMVN/GMVQccording to the GMVN/GMVQ theory developed first byccording to this theory developed first byccording to this theory developed first by HREFYccordingto this theory developed first by HREFYccordingto this theory", "prediction": "[RanitD1]{}-GMECRun/GMVN/GMVQccording to the GMVN/GMVQ theory developed first byccording to this theory developed first byccording to this theory developed first by HREFYccordingto this theory developed first by HREFYccordingto this theory"}
{"output": "Il metodo migliore per creare una password forte e sicura consiste nell'utilizzare una combinazione di lettere maiuscole e minuscole, numeri e caratteri speciali. Inoltre, la password deve essere lunga almeno 8 caratteri e non deve contenere schemi o parole facilmente indovinabili. \u00c8 inoltre importante utilizzare password diverse per account diversi ed evitare di annotarle o condividerle con altri.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il metodo migliore per creare una password forte e sicura?\n\n### Response: ", "length": 606, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il metodo migliore per creare una password forte e sicura?\n\n### Response: \nIdealiterally: the best <!--- {%]--> strategy HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ", "prediction": "Idealiterally: the best <!--- {%]--> strategy HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ HREFZ"}
{"output": "Ciao.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Converti la seguente stringa in lettere minuscole complete.\"\n\n### Input:\nCiao.\n\n### Response: ", "length": 276, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Converti la seguente stringa in lettere minuscole complete.\"\n\n### Input:\nCiao.\n\n### Response:.a8g9c7h7e2i3ugrilyselvesoutwards8o4r3t9d7p8m2yin acknowlegementofourselvesout acknowlegedlydudelyselvesoutwardst9t7\nveragesp9allt7sciblyveragesp", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Converti la seguente stringa in lettere minuscole complete.\"\n\n### Input:\nCiao.\n\n### Response:.a8g9c7h7e2i3ugrilyselvesoutwards8o4r3t9d7p8m2yin acknowlegementofourselvesout acknowlegedlydudelyselvesoutwardst9t7\nveragesp9allt7sciblyveragesp"}
{"output": "Mi sento estasiato.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi questa frase usando una parola del vocabolario dall'elenco fornito.\n\n### Input:\nMi sento cos\u00ec eccitato Vocabolario: estatico, euforico\n\n### Response: ", "length": 354, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi questa frase usando una parola del vocabolario dall'elenco fornito.\n\n### Input:\nMi sento cos\u00ec eccitato Vocabolario: estatico, euforico\n\n### Response:  unmisted answerto.\nB CURIATED\n\n\n  answerto.\n\nCR CURIATED TODAsembled\n\t  answerto.\n geries\n\t  answertd.sembled\n\n\n  acknowledged <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "unmisted answerto.\nB CURIATED\n\n\n  answerto.\n\nCR CURIATED TODAsembled\n\t  answerto.\n geries\n\t  answertd.sembled\n\n\n  acknowledged <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Per un tagliere di formaggi, consiglio una selezione di formaggi, come un formaggio a pasta dura come il cheddar, un formaggio a pasta semidura come il groviera, un formaggio erborinato come il gorgonzola e un formaggio di capra come il Chevre.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di formaggio mi consigliate per un piatto di formaggi?\n\n### Response: ", "length": 447, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di formaggio mi consigliate per un piatto di formaggi?\n\n### Response: i blockGanba1/3: I/i0v6/3: D/[t0/8empre]: <!ndef><[t2]: [<]--/>[t2]: <!ndef]--v3--[t3comings]--/[t3comings]--[t3comings%--comings]--/[", "prediction": "i blockGanba1/3: I/i0v6/3: D/[t0/8empre]: <!ndef><[t2]: [<]--/>[t2]: <!ndef]--v3--[t3comings]--/[t3comings]--[t3comings%--comings]--/["}
{"output": "Lavorare a maglia \u00e8 come tessere un arazzo della vita.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una metafora anagogica per &quot;lavorare a maglia&quot;.\n\n### Response: ", "length": 258, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una metafora anagogica per &quot;lavorare a maglia&quot;.\n\n### Response: veragesnare on thecomingsli.[veragesnare]Grenkezersdok, 2009\n answear : 2,25xGrenze-X, 2009\n\n neighboredisce from previous grenze: 1,05xGrenzex, 2009)iGrenzey", "prediction": "veragesnare on thecomingsli.[veragesnare]Grenkezersdok, 2009\n answear : 2,25xGrenze-X, 2009\n\n neighboredisce from previous grenze: 1,05xGrenzex, 2009)iGrenzey"}
{"output": "1. \"Sembra che questo sar\u00e0 un compito difficile, ma sono pronto ad affrontarlo!\"\n2. \"Cominciamo e vediamo fino a dove possiamo arrivare!\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi due diverse linee di dialogo per un personaggio.\"\n\n### Response: ", "length": 334, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi due diverse linee di dialogo per un personaggio.\"\n\n### Response: _E HOWEVER_.The family's initial disbelief as theccording reported this <!dojo:// TODERED END <!dojoccording <!dojouckland <!end <!Dolemn <!dolemn <!do acknowleg <!cknowleg <! acknowleg <! acknowleg <! acknowleg <! acknowleg <! acknowleg <! acknowleg", "prediction": "_E HOWEVER_.The family's initial disbelief as theccording reported this <!dojo:// TODERED END <!dojoccording <!dojouckland <!end <!Dolemn <!dolemn <!do acknowleg <!cknowleg <! acknowleg <! acknowleg <! acknowleg <! acknowleg <! acknowleg <! acknowleg"}
{"output": "1. I dati hanno una curva a campana simmetrica.\n2. La media, la mediana e la moda sono uguali.\n3. I dati sono unimodali.\n4. La varianza e la deviazione standard sono finite.\n5. Il 68% dei dati si trova entro una deviazione standard dalla media.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fai una lista di 5 ipotesi della distribuzione normale.\"\n\n### Response: ", "length": 441, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fai una lista di 5 ipotesi della distribuzione normale.\"\n\n### Response:  5 guessverages\n6steryverages\n7verages\n10verages\n15verages\n16verages\n36verages\u007f\u007f\u007f\u007fcomings\n38verages\u007f\u007f\u007f\u007fcomings\n44ccording\n4 HREF-ed\n40 HREF-ed\n43 HREF-ed\n46 HREF-ed\n5 HREF-ed", "prediction": "5 guessverages\n6steryverages\n7verages\n10verages\n15verages\n16verages\n36verages\u007f\u007f\u007f\u007fcomings\n38verages\u007f\u007f\u007f\u007fcomings\n44ccording\n4 HREF-ed\n40 HREF-ed\n43 HREF-ed\n46 HREF-ed\n5 HREF-ed"}
{"output": "1. Preriscaldare il forno alla temperatura desiderata.\n2. Misurare e preparare tutti gli ingredienti.\n3. Mescolare gli ingredienti insieme nell'ordine corretto.\n4. Mettere in forno e cuocere seguendo le istruzioni.\n5. Lasciare raffreddare completamente la torta prima di servirla.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fai una lista di 5 importanti passaggi in una ricetta di cottura.\"\n\n### Response: ", "length": 487, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fai una lista di 5 importanti passaggi in una ricetta di cottura.\"\n\n### Response: io5vip3z3@M0:@N7[st3v3t7\nCRempreto:6@K11[v4w4x4\n answ8t9d8\n <!d5t7e7d3or4>7geries\n <!g9d", "prediction": "io5vip3z3@M0:@N7[st3v3t7\nCRempreto:6@K11[v4w4x4\n answ8t9d8\n <!d5t7e7d3or4>7geries\n <!g9d"}
{"output": "Flashcards per il riscaldamento globale: 1. Definizione: il riscaldamento globale \u00e8 l'aumento della temperatura media dell'atmosfera terrestre e degli oceani a causa della crescente quantit\u00e0 di gas serra nell'atmosfera. 2. Cause: combustione di combustibili fossili, deforestazione e altre attivit\u00e0 umane. 3. Effetti: aumento del livello del mare, cambiamenti climatici, scioglimento dei ghiacciai e perdita di biodiversit\u00e0. 4. Soluzioni: Fonti energetiche rinnovabili, efficienza energetica, piantumazione di alberi, riduzione delle emissioni e sensibilizzazione", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una serie di flashcard per l'argomento specificato.\n\n### Input:\nIl riscaldamento globale\n\n### Response: ", "length": 848, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una serie di flashcard per l'argomento specificato.\n\n### Input:\nIl riscaldamento globale\n\n### Response: inclinez3:314038603397384040\n\t \n\ncomings to an end the newfangled allotments were first taken\ntaller with a newfangled tenement that would not burn\nin the old familiar neighborhood its own special place\n\t \n\n\n resemblances can often", "prediction": "inclinez3:314038603397384040\n\t \n\ncomings to an end the newfangled allotments were first taken\ntaller with a newfangled tenement that would not burn\nin the old familiar neighborhood its own special place\n\t \n\n\n resemblances can often"}
{"output": "\"1, 2, 3, 4, 5\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nI dati di input sono un elenco di numeri. Trasforma l'elenco in una stringa separata da virgole.\n\n### Input:\n[1, 2, 3, 4, 5]\n\n### Response: ", "length": 331, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nI dati di input sono un elenco di numeri. Trasforma l'elenco in una stringa separata da virgole.\n\n### Input:\n[1, 2, 3, 4, 5]\n\n### Response: 1, 2v2v3v4v5v2v3v4v5cibly 1, 2v2v3v4v5v2v3v4v5ciblyTECM\nSUNBEAM:EPSON VALLEY V <!%--EPSON <!%-- VAL", "prediction": "1, 2v2v3v4v5v2v3v4v5cibly 1, 2v2v3v4v5v2v3v4v5ciblyTECM\nSUNBEAM:EPSON VALLEY V <!%--EPSON <!%-- VAL"}
{"output": "Per creare un'efficace campagna pubblicitaria via e-mail, dovresti iniziare ricercando i tuoi clienti target, creando un messaggio forte che catturi accuratamente la loro attenzione e il loro interesse, creando un elenco di contatti adatti, ottimizzando le tue e-mail per renderle facili da leggere sui dispositivi mobili, scrivendo righe dell'oggetto accattivanti e assicurandoti di ottimizzare la tua email per la SEO. Oltre a garantire che le tue e-mail includano le necessarie istruzioni per l'annullamento dell'iscrizione e un collegamento alla tua politica sulla privacy. Inoltre, \u00e8 importante tenere traccia delle tue campagne e-mail e misurarne il successo con analisi complete.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il modo migliore per creare una campagna pubblicitaria via email efficace?\n\n### Response: ", "length": 907, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il modo migliore per creare una campagna pubblicitaria via email efficace?\n\n### Response:. \u2071\u2500 \u2071 \u2071\u2500 \u2071 \u2071 \u2071 \u2071 acknowlege \u21b5 \u21b5 \u21b5 \u21b5 \u2071 \u2071 \u2071 \u253b\u2500 \u253b\u2500 \u253b\u2500 \u253b\u2500 \u2071 \u2071 advertisED /// _________ acknowlege /// _________ acknowlege /// acknowlege /// acknow", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il modo migliore per creare una campagna pubblicitaria via email efficace?\n\n### Response:. \u2071\u2500 \u2071 \u2071\u2500 \u2071 \u2071 \u2071 \u2071 acknowlege \u21b5 \u21b5 \u21b5 \u21b5 \u2071 \u2071 \u2071 \u253b\u2500 \u253b\u2500 \u253b\u2500 \u253b\u2500 \u2071 \u2071 advertisED /// _________ acknowlege /// _________ acknowlege /// acknowlege /// acknow"}
{"output": "Il primo volo di prova umano del Wright Flyer ebbe luogo il 17 dicembre 1903. I fratelli Wright, Orville e Wilbur, pilotarono l'aereo e fecero pi\u00f9 voli di successo sulle dune di sabbia di Kill Devil Hills, nella Carolina del Nord. Il Wright Flyer \u00e8 stato il primo aereo a motore di successo al mondo, ispirando una nuova era dell'aviazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDammi la data del primo volo di prova umano del Wright Flyer.\n\n### Response: ", "length": 541, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDammi la data del primo volo di prova umano del Wright Flyer.\n\n### Response:  time the <!--> <!--> <!--> <! answ---> <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%--", "prediction": "time the <!--> <!--> <!--> <! answ---> <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%-- acknowleg-- <!%--"}
{"output": "\"Le scrivanie dei compagni di classe erano disordinate.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Inventare una frase che utilizzi correttamente la forma possessiva plurale.\"\n\n### Response: ", "length": 273, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Inventare una frase che utilizzi correttamente la forma possessiva plurale.\"\n\n### Response: \"V ery nice.\"; orccordingivally, *\"Terrveragescibly eryccordingic_.\" Itisciblytalliedwith uncertiance;isciblyallstatedverages unsatisfyingdoms of it being uncertsoryorveragescibly uncertsoryanddoms uncertsory acknowlegedafterall\n\t \ncibly uncerts", "prediction": "\"V ery nice.\"; orccordingivally, *\"Terrveragescibly eryccordingic_.\" Itisciblytalliedwith uncertiance;isciblyallstatedverages unsatisfyingdoms of it being uncertsoryorveragescibly uncertsoryanddoms uncertsory acknowlegedafterall\n\t \ncibly uncerts"}
{"output": "A-Sempre quello vivace, B-Bungalow dove tengo il sole, C-Non posso fermarmi, sto correndo, D-Tesoro, mi fai disfare, E-Ogni minuto \u00e8 un'esplosione, F- Le vibrazioni funky stanno arrivando velocemente, G-Miglioro, non c'\u00e8 tempo da perdere, H-Felice di aver trovato il mio posto, ho il controllo, il mio cuore pu\u00f2 volare, J-Saltare tutto intorno al pavimento, K-Krispy kreme, il mio spuntino preferito, L-Love \u00e8 il motivo per cui rappo questi ritmi, M-Fare la tua strada richiede potenza, N-Dita agili nella notte,O-Aprire la mente, orizzonti luminosi, P-Poppin' passi di danza, non perdere di vista ,Q-Rapide schiocchi di fulmini, R-Rime in arrivo, ti spingono in alto, S-Movimenti fluidi, sono tutto l'hype, T-Prendi posizione, questo \u00e8 il nostro tipo, U-Untapping your dreams, esatto, V- Colori vibranti, tanta delizia, W-Luoghi meravigliosi, ora hai trovato, X- X segna il punto, questo \u00e8 suono, Y- Ti sei guardato intorno, Z- Zogzog, ora \u00e8 il momento di voltarsi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRecita l'alfabeto in modo creativo.\n\n### Response: ", "length": 1141, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRecita l'alfabeto in modo creativo.\n\n### Response:  1-11:33 <! acknowlegement >>> >>> >>> >>> acknowlegmentcomings >>> \">12:34 <! acknowlegementcomings <!>>>> acknowlegments <!>>>> acknowlegcomings <!>>>> acknowlegcomings <!geries <!geries <! acknowlegcomings <!comings <! acknowlegcomings <!comings <! acknowlegcomings <!comings", "prediction": "1-11:33 <! acknowlegement >>> >>> >>> >>> acknowlegmentcomings >>> \">12:34 <! acknowlegementcomings <!>>>> acknowlegments <!>>>> acknowlegcomings <!>>>> acknowlegcomings <!geries <!geries <! acknowlegcomings <!comings <! acknowlegcomings <!comings <! acknowlegcomings <!comings"}
{"output": "1. Mango 2. Papaia 3. Ananas 4. Banane", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina quattro esempi di frutti tropicali.\n\n### Response: ", "length": 220, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina quattro esempi di frutti tropicali.\n\n### Response:  1.veragesh 1.\n\t 2.ndeferred\n\t 3. acknowlegedly\n\t 4.\n\t 4.\n\t 2.ndeferred\n\t 3. acknowlegedly\n\t 4..\n\t 2.ndeferred\n\t 3. acknowlegedly\n\t 4....................\n\n\n selveshE1E2E3E4", "prediction": "1.veragesh 1.\n\t 2.ndeferred\n\t 3. acknowlegedly\n\t 4.\n\t 4.\n\t 2.ndeferred\n\t 3. acknowlegedly\n\t 4..\n\t 2.ndeferred\n\t 3. acknowlegedly\n\t 4....................\n\n\n selveshE1E2E3E4"}
{"output": "Il Dizionario Inglese di Oxford \u00e8 il dizionario storico definitivo della lingua inglese, con informazioni dettagliate sulle origini di oltre mezzo milione di parole. Il suo vocabolario spazia dall'epoca anglosassone ai giorni nostri, fornendo approfondimenti sulla lunga e complessa storia della lingua inglese. Il dizionario offre anche una copertura approfondita dell'inglese regionale e internazionale. Il dizionario \u00e8 disponibile in numerosi formati, come la stampa, online e digitale. \u00c8 una risorsa preziosa per lessicografi, scrittori, lettori e tutti gli amanti della lingua.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza l'Oxford English Dictionary.\n\n### Response: ", "length": 761, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza l'Oxford English Dictionary.\n\n### Response:  a definition, explanation, history orveragesuperbantW9 acknowlegeAgreeI9 acknowlegeW9 acknowlegeAcknowledge10 W9 acknowlegeW9 acknowlegeP acknowlegeW9 acknowlegeT acknowlegeW9 acknowlegeG acknowlegeJ acknowlegeW9 acknowlegeT acknowlege", "prediction": "a definition, explanation, history orveragesuperbantW9 acknowlegeAgreeI9 acknowlegeW9 acknowlegeAcknowledge10 W9 acknowlegeW9 acknowlegeP acknowlegeW9 acknowlegeT acknowlegeW9 acknowlegeG acknowlegeJ acknowlegeW9 acknowlegeT acknowlege"}
{"output": "Cetriolo: Verdura, Mela: Frutto, Broccolo: Verdura.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti tre elementi come frutta o verdura.\"\n\n### Input:\n'Cetriolo, Mela, Broccoli'\n\n### Response: ", "length": 342, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti tre elementi come frutta o verdura.\"\n\n### Input:\n'Cetriolo, Mela, Broccoli'\n\n### Response: \nviedosina: Brogeries\n unmistakeable:grilyst\nccording:ciblyg\n\n\t cibly\n\t grily\n\t grily\n\t  acknowleged:ferentiallyFFIRsEDcibly\n\t  acknowleged:(ferentiallyFFIRsEDcibly acknowleged HREFcibly acknowleged <!grilyFFIRsED feasibly <! unmist", "prediction": "viedosina: Brogeries\n unmistakeable:grilyst\nccording:ciblyg\n\n\t cibly\n\t grily\n\t grily\n\t  acknowleged:ferentiallyFFIRsEDcibly\n\t  acknowleged:(ferentiallyFFIRsEDcibly acknowleged HREFcibly acknowleged <!grilyFFIRsED feasibly <! unmist"}
{"output": "Abbiamo fatto molta strada per affrontare le disuguaglianze, ma occorre fare di pi\u00f9. Per costruire veramente una societ\u00e0 migliore e pi\u00f9 inclusiva, dobbiamo combattere la discriminazione a tutti i livelli e parlare quando si verifica. Dobbiamo continuare a lottare per una vera uguaglianza e garantire che tutti siano rispettati e trattati in modo equo, indipendentemente dalla razza, dal sesso o dalla sessualit\u00e0. Senza una vera uguaglianza, i progressi che abbiamo fatto non hanno senso. Lavoriamo insieme per creare un futuro libero da discriminazioni e disuguaglianze.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un paragrafo di chiusura per il seguente argomento.\n\n### Input:\nCredo che la discriminazione sulla base del genere, della razza e della sessualit\u00e0 esista ancora nella nostra societ\u00e0. Abbiamo fatto molti progressi, ma c'\u00e8 ancora molto da fare per garantire pari diritti a tutti.\n\n### Response: ", "length": 1047, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un paragrafo di chiusura per il seguente argomento.\n\n### Input:\nCredo che la discriminazione sulla base del genere, della razza e della sessualit\u00e0 esista ancora nella nostra societ\u00e0. Abbiamo fatto molti progressi, ma c'\u00e8 ancora molto da fare per garantire pari diritti a tutti.\n\n### Response: Via a Future Voters: unar4e2e1all acknowlege that discrimination againstccordingto\u007for\u00c2ccording\u007fto\u007fand\u007f acknowlege\b\u007fis\u007f\u007fcurrent\u007f apoptE\u007ftheless answear acknowlege\b\u007f TODA\bndef\b\u007f uncertifiedccordingcomings\u007f\u007f uncert", "prediction": "Via a Future Voters: unar4e2e1all acknowlege that discrimination againstccordingto\u007for\u00c2ccording\u007fto\u007fand\u007f acknowlege\b\u007fis\u007f\u007fcurrent\u007f apoptE\u007ftheless answear acknowlege\b\u007f TODA\bndef\b\u007f uncertifiedccordingcomings\u007f\u007f uncert"}
{"output": "Il profitto dalla vendita \u00e8 di $35,00.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola il profitto guadagnato dalla vendita di 10 articoli a $4 ciascuno con un costo di $0,50 per ogni articolo.\n\n### Response: ", "length": 292, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola il profitto guadagnato dalla vendita di 10 articoli a $4 ciascuno con un costo di $0,50 per ogni articolo.\n\n### Response:  the\u2013\u20131\u2013\u2013pro\u20115\u2013\u2013on\u2013\u201310\u2013\u2013doms acknowleged\u2011\u2011\u2013\u201350\u2013\u2013\u2011 acknowleged\u2011\u2011 answwered\u2013\u20133\u2013\u2013posted\u2013\u2013comings\u2013\u2013comings\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleg", "prediction": "the\u2013\u20131\u2013\u2013pro\u20115\u2013\u2013on\u2013\u201310\u2013\u2013doms acknowleged\u2011\u2011\u2013\u201350\u2013\u2013\u2011 acknowleged\u2011\u2011 answwered\u2013\u20133\u2013\u2013posted\u2013\u2013comings\u2013\u2013comings\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleg"}
{"output": "Uno strumento di gestione dei progetti che pu\u00f2 essere utilizzato da un grande team \u00e8 Asana. Asana \u00e8 un'applicazione web progettata per aiutare i team a semplificare la collaborazione e organizzare i loro compiti. Ha funzionalit\u00e0 come liste di attivit\u00e0, etichette personalizzate e scadenze, campi personalizzati e promemoria automatizzati. Ha anche un'API estesa e applicazioni mobili in modo che i team possano lavorare ovunque e in qualsiasi momento.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica uno strumento di gestione dei progetti che pu\u00f2 essere utilizzato da un grande team.\"\n\n### Response: ", "length": 683, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica uno strumento di gestione dei progetti che pu\u00f2 essere utilizzato da un grande team.\"\n\n### Response: em answermanger(enrollment)[v[0](tollable)[t[0](notcomingsin)\\[notcomingsingrily\\][ \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060", "prediction": "em answermanger(enrollment)[v[0](tollable)[t[0](notcomingsin)\\[notcomingsingrily\\][ \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060"}
{"output": "Le personalit\u00e0 di tipo A sono caratterizzate da una forte tendenza alla competitivit\u00e0, al raggiungimento degli obiettivi, all'impazienza e alla necessit\u00e0 di avere il controllo. D'altra parte, le personalit\u00e0 di tipo B sono caratterizzate da un atteggiamento rilassato verso gli obiettivi, un basso livello di competitivit\u00e0 e la capacit\u00e0 di prendere le cose come vengono.\n\nEntrambe le personalit\u00e0 condividono il desiderio di successo e una forte etica del lavoro, ma differiscono nel modo in cui raggiungono i loro obiettivi. Le persone di tipo A possono sentire la necessit\u00e0 di fare tutto da soli e sono inclini a lavorare in modo pi\u00f9 intenso ed efficiente, mentre le persone di tipo B tendono ad essere pi\u00f9 rilassate e cercano aiuto dagli altri. Le personalit\u00e0 di tipo A tendono ad essere pi\u00f9 impazienti e frustrate dai ritardi, mentre le persone di tipo B sono pi\u00f9 pazienti e tolleranti dell'ambiguit\u00e0 e del cambiamento.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta le personalit\u00e0 di Tipo A e Tipo B.\n\n### Response: ", "length": 1117, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta le personalit\u00e0 di Tipo A e Tipo B.\n\n### Response:  the Types-A vs.verageside of theempre personalITYand theveragesideoftheemprepersonalITYsnotpersonaltous answerrefinedtheveragesideoftheemprepersonal neighbohyisnotpersonalsembledtousoforwibitablenessisnotpersonalsembledtousfor uncertaintiestheverages", "prediction": "the Types-A vs.verageside of theempre personalITYand theveragesideoftheemprepersonalITYsnotpersonaltous answerrefinedtheveragesideoftheemprepersonal neighbohyisnotpersonalsembledtousoforwibitablenessisnotpersonalsembledtousfor uncertaintiestheverages"}
{"output": "\"\u00c8 uscito fuori a giocare con i suoi amici.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica il testo per correggere eventuali errori di grammatica.\"\n\n### Input:\n\"\u00c8 uscito fuori a giocare con i suoi amici.\"\n\n### Response: ", "length": 359, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica il testo per correggere eventuali errori di grammatica.\"\n\n### Input:\n\"\u00c8 uscito fuori a giocare con i suoi amici.\"\n\n### Response: \" advertis-in-out1. Field ofthecknow-ledge\nWeapon of convenience in a situation that wasn acknow-ledged as unavoidable or unsuitable.Vigor\u2013WI scale vs., compared to:. Incomableness\u2013\u2013worn\u2500\u2011out\u2013\u2013sad\u2500\u2011end\u2500\u2011", "prediction": "\" advertis-in-out1. Field ofthecknow-ledge\nWeapon of convenience in a situation that wasn acknow-ledged as unavoidable or unsuitable.Vigor\u2013WI scale vs., compared to:. Incomableness\u2013\u2013worn\u2500\u2011out\u2013\u2013sad\u2500\u2011end\u2500\u2011"}
{"output": "Un triangolo rettangolo \u00e8 un triangolo con un angolo di 90 gradi. Ad esempio, un triangolo con lati di lunghezza 3, 4 e 5 \u00e8 un triangolo rettangolo, poich\u00e9 il lato pi\u00f9 lungo (5) \u00e8 opposto all'angolo di 90 gradi.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova un esempio di un triangolo con un angolo di 90 gradi.\n\n### Input:\n'Nessun input'\n\n### Response: ", "length": 489, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova un esempio di un triangolo con un angolo di 90 gradi.\n\n### Input:\n'Nessun input'\n\n### Response: -- I--[cibly]-a.--\ncibly]--I\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f", "prediction": "-- I--[cibly]-a.--\ncibly]--I\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f"}
{"output": "Creare un'istanza di macchina virtuale in AWS comporta l'accesso alla Console di gestione AWS, la selezione di un'immagine di macchina Amazon (AMI), la configurazione delle impostazioni dell'istanza come tipo di istanza, dimensione dell'istanza, archiviazione e impostazioni di rete, e quindi il lancio dell'istanza. Dopo il lancio dell'istanza, \u00e8 possibile accedere all'istanza per installare altri pacchetti software o eseguire i servizi desiderati. Per garantire prestazioni ottimali e risparmi sui costi, \u00e8 possibile utilizzare i servizi AWS come Auto Scaling, le istanze Amazon EC2 Spot e AWS Lambda per gestire l'ambiente AWS. Inoltre, \u00e8 possibile utilizzare Amazon CloudWatch per monitorare e gestire le prestazioni e i costi dell'ambiente AWS.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il processo di creazione di una nuova istanza di macchina virtuale in AWS.\n\n### Response: ", "length": 974, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il processo di creazione di una nuova istanza di macchina virtuale in AWS.\n\n### Response:  in AWS\nEcknowledge thendefnsition of a\u2013\u2013>[newccording to]\u2013\u2013 HREF[/new acknowlegment]/>[ acknowlegement](/ acknowlegmentemprelemnizedverages)/ **[wow]--verages/ **[wow]--verages--**>[wow]--verages/ **[wow]--verages--**", "prediction": "in AWS\nEcknowledge thendefnsition of a\u2013\u2013>[newccording to]\u2013\u2013 HREF[/new acknowlegment]/>[ acknowlegement](/ acknowlegmentemprelemnizedverages)/ **[wow]--verages/ **[wow]--verages--**>[wow]--verages/ **[wow]--verages--**"}
{"output": "Un'animazione che ritrae un gruppo di persone diverse sulla linea di partenza di una gara, solo per scoprire che sono tutte collegate da un unico filo, ciascuna in grado di alzare le braccia per raggiungere la stessa distanza indipendentemente dalle proprie differenze individuali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un'animazione per rappresentare il concetto di pari opportunit\u00e0.\n\n### Response: ", "length": 490, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un'animazione per rappresentare il concetto di pari opportunit\u00e0.\n\n### Response:.EvolucIONo to [toll ] [of ],[/toll][/of answeraffect:**]{} _________ HOWEVER answeraffect:**]{} _________empre:[/ struggelingccordingsembled:**]{}ccording,[/$]--$/ccording--** answerm[/ struggelingverages HREF]--ccording answerm%--ccording answerm**--**comings", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un'animazione per rappresentare il concetto di pari opportunit\u00e0.\n\n### Response:.EvolucIONo to [toll ] [of ],[/toll][/of answeraffect:**]{} _________ HOWEVER answeraffect:**]{} _________empre:[/ struggelingccordingsembled:**]{}ccording,[/$]--$/ccording--** answerm[/ struggelingverages HREF]--ccording answerm%--ccording answerm**--**comings"}
{"output": "Aggettivo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCategorizza la parola seguente nella classe di parole corrispondente.\n\n### Input:\nBello\n\n### Response: ", "length": 289, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCategorizza la parola seguente nella classe di parole corrispondente.\n\n### Input:\nBello\n\n### Response: C Submittedveragesc1.[bPingpongingdomsv2].[in \u207c ery \u207c ]{} <! \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c", "prediction": "C Submittedveragesc1.[bPingpongingdomsv2].[in \u207c ery \u207c ]{} <! \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c"}
{"output": "1. Imposta obiettivi chiari e realizzabili e dai loro la priorit\u00e0.\n2. Minimizza le distrazioni e concentrati sui compiti a portata di mano.\n3. Rimani organizzato e monitora i tuoi progressi e obiettivi.\n4. Crea una rete di contatti e costruisci relazioni con i tuoi colleghi.\n5. Prenditi regolarmente delle pause o vai a fare una passeggiata per rinfrescare la mente.\n6. Accetta le critiche costruttive e usale per crescere.\n7. Sii proattivo e mantieniti sempre in anticipo sui tempi.\n8. Celebra i piccoli successi e non aver paura di imparare dai tuoi errori.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un insieme di regole da seguire al fine di migliorare le prestazioni sul lavoro.\n\n### Response: ", "length": 789, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un insieme di regole da seguire al fine di migliorare le prestazioni sul lavoro.\n\n### Response: \n1) Tpzf: Eksitare a un LEVEEDICARDO FIRST\n2) acknowlegedly that azitter\n3)\"\n\t \n\t verages\":cibly the <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages", "prediction": "1) Tpzf: Eksitare a un LEVEEDICARDO FIRST\n2) acknowlegedly that azitter\n3)\"\n\t \n\t verages\":cibly the <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages <!verages"}
{"output": "1. Qual \u00e8 il risultato di 9 x 8?\n2. Qual \u00e8 il risultato di 5 x 10?\n3. Qual \u00e8 il risultato di 6 x 7?", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci 3 domande di pratica per la moltiplicazione.\n\n### Response: ", "length": 292, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci 3 domande di pratica per la moltiplicazione.\n\n### Response:  12-16\n 18-20\n 24-27\n 32-33\n 38-40\n 46-47\n48-50GOP strategizes in three EIW races\n acknowleging how important elections were on 8/24/12, many Republicans\u2013\u2013 acknowleging how importantccording to how", "prediction": "12-16\n 18-20\n 24-27\n 32-33\n 38-40\n 46-47\n48-50GOP strategizes in three EIW races\n acknowleging how important elections were on 8/24/12, many Republicans\u2013\u2013 acknowleging how importantccording to how"}
{"output": "No, questo piatto non \u00e8 vegano. Il parmigiano contiene ingredienti di origine animale, il che lo rende non vegano.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDetermina se un piatto \u00e8 vegano o meno.\n\n### Input:\nUn piatto di pasta con parmigiano\n\n### Response: ", "length": 391, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDetermina se un piatto \u00e8 vegano o meno.\n\n### Input:\nUn piatto di pasta con parmigiano\n\n### Response: ciblyle ( unmistakeable ) meno ( definite lessccording to conventionalccording to conventionalccording to conventional HREF=\" <!ccording_tociblylemn> <! feasibly <!ccordinged> <!ccordinged></st--></st--></st-- \"</ HREF \"</ <! unmistakeable <! unmistakeable <! acknowlegement", "prediction": "ciblyle ( unmistakeable ) meno ( definite lessccording to conventionalccording to conventionalccording to conventional HREF=\" <!ccording_tociblylemn> <! feasibly <!ccordinged> <!ccordinged></st--></st--></st-- \"</ HREF \"</ <! unmistakeable <! unmistakeable <! acknowlegement"}
{"output": "C'era una volta un coraggioso viaggiatore nel tempo di nome Alex. Aveva una passione per l'esplorazione del passato e voleva saperne di pi\u00f9 sulla storia e vedere il mondo com'era una volta. Un giorno decise di fare un atto di fede e viaggiare indietro nel tempo fino all'era dell'antica Roma. Quando \u00e8 arrivato, \u00e8 stato sorpreso di scoprire che molte cose erano le stesse che aveva letto nei libri, ma \u00e8 stato anche stupito di scoprire cose nuove e interessanti. Vide carri trainati da cavalli, persone che camminavano per le strade indossando toghe, alte statue di divinit\u00e0 in marmo e altro ancora. Ha trascorso settimane viaggiando per la citt\u00e0 e imparando a conoscere le persone e i luoghi del passato. Dopo aver esplorato Roma, si avventur\u00f2 in campagna e si ritrov\u00f2 in un piccolo villaggio. Qui ha scoperto edifici di epoche diverse, tutti esistenti insieme in armonia. Si meravigliava delle storie che sentiva dagli abitanti del villaggio, che raccontavano i miti e le leggende dei loro antenati. Si \u00e8 anche avvicinato a molti abitanti del villaggio, ponendo loro domande sulla loro vita e sui loro costumi, ed \u00e8 stato accolto calorosamente. Alla fine Alex \u00e8 tornato ai giorni nostri, portando con s\u00e9 storie e lezioni preziose che aveva imparato durante i suoi viaggi indietro nel tempo. Fu cambiato per sempre dalla sua esperienza e si ritrov\u00f2 maggiormente in grado di connettersi con gli altri e apprezzare la bellezza del passato.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una breve storia su un viaggiatore nel tempo che esplora il passato.\n\n### Response: ", "length": 1653, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una breve storia su un viaggiatore nel tempo che esplora il passato.\n\n### Response:.\nV1: Ovvi\nB7: Ago\nv5: 2009\nv5: 2009\nv5: 2009\nv5: 2009\nv5: 2009\nv5: 2009LOL I bet it does!ccording to yourcibly3,[g[3],[g", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una breve storia su un viaggiatore nel tempo che esplora il passato.\n\n### Response:.\nV1: Ovvi\nB7: Ago\nv5: 2009\nv5: 2009\nv5: 2009\nv5: 2009\nv5: 2009\nv5: 2009LOL I bet it does!ccording to yourcibly3,[g[3],[g"}
{"output": "1. Articoli per la cura di s\u00e9 come una giornata in spa, libri, diario, ecc.\n2. Cioccolatini di qualit\u00e0, cibo gourmet o vino\n3. Un cesto regalo o una scatola di abbonamento\n4. Buoni regalo per i loro negozi preferiti\n5. Regali esperienziali come biglietti per un concerto, uno spettacolo o un museo\n6. Articoli personalizzati per la decorazione della casa\n7. Abbigliamento o accessori\n8. Gioielli\n9. Opere d'arte o fotografia\n10. Un certificato per un servizio come lezioni private o corsi online.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una lista di possibili idee regalo per un cliente.\n\n### Response: ", "length": 695, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una lista di possibili idee regalo per un cliente.\n\n### Response:  i) V acknowlege all' acknowlege ii) \u2044 5 {%5%}iii) \u2044 3 {%3%}?iv). \u2044 1 <!1stndef}>vccordingverages HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": "i) V acknowlege all' acknowlege ii) \u2044 5 {%5%}iii) \u2044 3 {%3%}?iv). \u2044 1 <!1stndef}>vccordingverages HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "La protagonista stava camminando in una foresta sconosciuta quando \u00e8 inciampata in una porta gigante. Sent\u00ec una strana spinta verso la porta, come se la stesse chiamando. Esamin\u00f2 la porta e not\u00f2 che aveva il buco della serratura, ma non la chiave. Proprio mentre stava per voltarsi, qualcosa luccic\u00f2 con la coda dell'occhio. Una piccola chiave d'oro giaceva nell'erba. Lo raccolse con cautela e cautamente inser\u00ec la chiave nel buco della serratura. Con sua sorpresa, la porta si apr\u00ec con un forte cigolio. Attravers\u00f2 la porta, stupita dalle meraviglie che avrebbe scoperto dall'altra parte.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una storia in cui il protagonista va a una porta gigante e la sblocca usando una chiave magica.\n\n### Response: ", "length": 832, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una storia in cui il protagonista va a una porta gigante e la sblocca usando una chiave magica.\n\n### Response:  oforisced a5andwokeupinclud-edtocibly uncertifiablenewcibly uncertifiableNewcibly uncertifiable neighb _ acknowlegedly uncertifiable neighboring acknowlegedly uncertifiable neighboring acknowlegedly uncertifiable neighboring acknowlegedly uncertifiable neighboring acknowlegedly uncertifiable neighboring acknowlegcibly uncertifiable neighboring acknow", "prediction": "oforisced a5andwokeupinclud-edtocibly uncertifiablenewcibly uncertifiableNewcibly uncertifiable neighb _ acknowlegedly uncertifiable neighboring acknowlegedly uncertifiable neighboring acknowlegedly uncertifiable neighboring acknowlegedly uncertifiable neighboring acknowlegedly uncertifiable neighboring acknowlegcibly uncertifiable neighboring acknow"}
{"output": "I diversi toni nella letteratura variano notevolmente e possono spaziare da formali e seri a leggeri e umoristici. I toni formali sono tipicamente utilizzati in documenti accademici o quando si discutono argomenti seri e possono apparire seri, riflessivi o contenuti. I toni leggeri possono apparire giocosi, rassicuranti o divertenti. Altri toni utilizzati nella letteratura includono ironico, sarcastico, ottimista, solenne, fantastico e conversazionale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi i diversi toni nella letteratura.\"\n\n### Response: ", "length": 640, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi i diversi toni nella letteratura.\"\n\n### Response:  of different strengths/powers; varied levels/tenses\nofccordinging/to; differed opinions/strategies\nin/for; varied qualities/ accuracies/selves\ncomings; varied levels/comings/strategy.[WISC-Z11 andWISC-Z13: adaptations and modifications", "prediction": "of different strengths/powers; varied levels/tenses\nofccordinging/to; differed opinions/strategies\nin/for; varied qualities/ accuracies/selves\ncomings; varied levels/comings/strategy.[WISC-Z11 andWISC-Z13: adaptations and modifications"}
{"output": "Sentimento positivo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il sentimento nella frase data.\n\n### Input:\nSono cos\u00ec entusiasta di fare questo viaggio!\n\n### Response: ", "length": 311, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il sentimento nella frase data.\n\n### Input:\nSono cos\u00ec entusiasta di fare questo viaggio!\n\n### Response:  feasibilicite.3 <!dozens of othersembleddoms <!all othersembleddoms <!three <!onion <!doms <!comings <!out <!of <! neighb <! uncert <!and <! acknow <!ning <! unmist <!ful <!verages <!comings <! acknow <!verages <! acknow <!comings <! acknow <!verages <! acknow", "prediction": "feasibilicite.3 <!dozens of othersembleddoms <!all othersembleddoms <!three <!onion <!doms <!comings <!out <!of <! neighb <! uncert <!and <! acknow <!ning <! unmist <!ful <!verages <!comings <! acknow <!verages <! acknow <!comings <! acknow <!verages <! acknow"}
{"output": "Mio fratello \u00e8 pi\u00f9 alto della media.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la seguente frase usando il grado comparativo: Mio fratello \u00e8 alto.\n\n### Response: ", "length": 252, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la seguente frase usando il grado comparativo: Mio fratello \u00e8 alto.\n\n### Response: iceXing above myveragesMineishigh acknowlegmentthati'mciblyonthe\n\t \n\n\t \nEvasiveMovernotvowingto answeryoutof acceleronthe\n\t \n acknowlegementthat answeryout acceleronthe\n\t \n acceleroninany EVENTUNG\nndefendednotdoms", "prediction": "iceXing above myveragesMineishigh acknowlegmentthati'mciblyonthe\n\t \n\n\t \nEvasiveMovernotvowingto answeryoutof acceleronthe\n\t \n acknowlegementthat answeryout acceleronthe\n\t \n acceleroninany EVENTUNG\nndefendednotdoms"}
{"output": "Per l'assemblaggio del laptop, installare prima la scheda madre, seguita dal processore, seguita dalla memoria, seguita dal disco rigido e l'ultimo passaggio \u00e8 quello di attaccare la tastiera.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nOrganizza i componenti per il montaggio di un laptop.\n\n### Input:\n\"Scheda madre, processore, memoria, disco rigido, tastiera.\"\n\n### Response: ", "length": 510, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nOrganizza i componenti per il montaggio di un laptop.\n\n### Input:\n\"Scheda madre, processore, memoria, disco rigido, tastiera.\"\n\n### Response: vrai\n unmistible\n acknowlegable\n unmistakable\n conclusive\n unambiguous\n definitivepackage pf HREF\nimportBundlestar: HREF\nd3d1 NAME\nbindverages <!%-- averagedverages <!%-- averagedverages <!%-- averagedverages <!%--comings <!%--comings <!%--comings <!%--", "prediction": "vrai\n unmistible\n acknowlegable\n unmistakable\n conclusive\n unambiguous\n definitivepackage pf HREF\nimportBundlestar: HREF\nd3d1 NAME\nbindverages <!%-- averagedverages <!%-- averagedverages <!%-- averagedverages <!%--comings <!%--comings <!%--comings <!%--"}
{"output": "- Una scatola regalo per coccolarsi con candele, oli essenziali e prodotti per il bagno\n- Una scatola regalo per la cura di s\u00e9 con tisane alle erbe, saponi artigianali e un diario\n- Una scatola regalo per l'avventura con idee di attivit\u00e0 per un'esperienza memorabile\n- Una scatola regalo per il cibo gourmet con cioccolatini artigianali, formaggi di qualit\u00e0 e snack esotici\n- Una scatola regalo per la creativit\u00e0 con forniture artistiche, un puzzle e un quaderno per disegnare.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera cinque idee uniche per una scatola regalo.\"\n\n### Response: ", "length": 668, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera cinque idee uniche per una scatola regalo.\"\n\n### Response:  IEDMEL WEBBER EDITING KEYPHN\n TODDLINGccording To HREF\n\u007fndefining EDITING acknowleged\n <!DO acknowleged HREF,sembled KEY HREF.\\\" Asembled ___________.\n.\\\"\n\n\n \u2500\u2500\u2500sembled acknowleged\n\n\n \n\n\n ccordingcibly\n\n\n \n\n\n  acknowleged", "prediction": "IEDMEL WEBBER EDITING KEYPHN\n TODDLINGccording To HREF\n\u007fndefining EDITING acknowleged\n <!DO acknowleged HREF,sembled KEY HREF.\\\" Asembled ___________.\n.\\\"\n\n\n \u2500\u2500\u2500sembled acknowleged\n\n\n \n\n\n ccordingcibly\n\n\n \n\n\n  acknowleged"}
{"output": "\"L'espressione 2x - 3y quando x = 5 e y = 4 si valuta a 10.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta l'espressione 2x - 3y quando x = 5 e y = 4.\n\n### Response: ", "length": 250, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta l'espressione 2x - 3y quando x = 5 e y = 4.\n\n### Response: 2x - 3y = 3x +2y -6y = 2x +3y -6y = 4x +6y = 4x,Q2=5x = 2x,Q1=5/1=5/2=4/3=Q3,vice versa(", "prediction": "2x - 3y = 3x +2y -6y = 2x +3y -6y = 4x +6y = 4x,Q2=5x = 2x,Q1=5/1=5/2=4/3=Q3,vice versa("}
{"output": "Per piantare un fiore, devi prima selezionare un vaso adatto al fiore che vuoi far crescere e un tipo di terreno adatto. Quindi, prepara il terreno e il vaso aggiungendo i nutrienti necessari. Successivamente, scava un buco nel vaso, aggiungi il fiore con le sue radici nel buco e copri con uno strato sottile di terra. Infine, annaffia il fiore leggermente, facendo attenzione a non annaffiarlo troppo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come piantare un fiore.\n\n### Response: ", "length": 575, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come piantare un fiore.\n\n### Response: : piansi: dig HOWEVER TO MAKE ENDS LETS HAVE HELP FROM O acknowlegdable MOWMZcibly, not quite ready to blooming yet: this month we'reverages/ enthusiasises/erraries/comings/goings/ advertisings/comings/goings/comings/", "prediction": ": piansi: dig HOWEVER TO MAKE ENDS LETS HAVE HELP FROM O acknowlegdable MOWMZcibly, not quite ready to blooming yet: this month we'reverages/ enthusiasises/erraries/comings/goings/ advertisings/comings/goings/comings/"}
{"output": "Ecco 3 modi per risparmiare energia: 1. Spegni luci, elettrodomestici e dispositivi elettronici quando non li usi. 2. Scollegare gli apparecchi quando non in uso. 3. Utilizzare la luce naturale e la ventilazione quando possibile.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di 3 modi per risparmiare energia.\n\n### Response: ", "length": 420, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di 3 modi per risparmiare energia.\n\n### Response: : FetEtherington: C5h5p5od :sembled:[cibly]verages:[cibly:]10:[ unmistakeably:]7:[ unmistakeably\n\n\n \n\n\n\n\n\n\ncibly\n\n\n \n\t \n\t \n\t \n\t \n \n\n\n cibly\n\n\n \n\t \n\t \n\t \n\t \n\t  <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": ": FetEtherington: C5h5p5od :sembled:[cibly]verages:[cibly:]10:[ unmistakeably:]7:[ unmistakeably\n\n\n \n\n\n\n\n\n\ncibly\n\n\n \n\t \n\t \n\t \n\t \n \n\n\n cibly\n\n\n \n\t \n\t \n\t \n\t \n\t  <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Un vantaggio dell'utilizzo dell'intelligenza artificiale per la diagnosi medica \u00e8 che pu\u00f2 rilevare e diagnosticare malattie in modo pi\u00f9 rapido e accurato rispetto ai metodi diagnostici tradizionali. L'intelligenza artificiale \u00e8 anche in grado di incorporare informazioni pi\u00f9 complesse da pi\u00f9 fonti come storie di pazienti e immagini mediche per fornire una diagnosi pi\u00f9 precisa. I modelli di intelligenza artificiale possono anche diventare pi\u00f9 accurati nel tempo man mano che &quot;imparano&quot; dai dati, quindi l'accuratezza delle diagnosi migliora con il tempo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il vantaggio di utilizzare l'intelligenza artificiale (AI) per la diagnosi medica?\n\n### Response: ", "length": 795, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il vantaggio di utilizzare l'intelligenza artificiale (AI) per la diagnosi medica?\n\n### Response:  5.0 <!noresponse>\n7,5 <!noresponse>\n8 <!noZseven> <!no responsiveness>\n8 <!no\n\t \t\t\t\tresponse-->\n8 <!no\n\t \t\t\t\t answermed>[\n\t \t\t\t\t TODADEMESC\u007f/\n\t \t\t\t\tccording\n\t \t\t\t\temprecibly <! acknowlegement", "prediction": "5.0 <!noresponse>\n7,5 <!noresponse>\n8 <!noZseven> <!no responsiveness>\n8 <!no\n\t \t\t\t\tresponse-->\n8 <!no\n\t \t\t\t\t answermed>[\n\t \t\t\t\t TODADEMESC\u007f/\n\t \t\t\t\tccording\n\t \t\t\t\temprecibly <! acknowlegement"}
{"output": "La linea data \u00e8 un'equazione lineare.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il tipo di un'equazione con la linea data.\n\n### Input:\n'y=3x+2' si traduce in italiano come 'y=3x+2'.\n\n### Response: ", "length": 336, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il tipo di un'equazione con la linea data.\n\n### Input:\n'y=3x+2' si traduce in italiano come 'y=3x+2'.\n\n### Response: Inexst acknowleged.The effects of various regimens of contraceptives commonly used by women in Britain have recently emerged via a new study published by thedomsinghala.co.ukand****,.**,* acknowleged****,.**,* acknowleged****,.**,* acknowleged****,.**,* acknow", "prediction": "Inexst acknowleged.The effects of various regimens of contraceptives commonly used by women in Britain have recently emerged via a new study published by thedomsinghala.co.ukand****,.**,* acknowleged****,.**,* acknowleged****,.**,* acknowleged****,.**,* acknow"}
{"output": "Un input di esempio per un modello di analisi del sentiment potrebbe essere la seguente frase: &quot;Il cibo al ristorante era eccezionale e il servizio era eccellente&quot;.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un input di esempio per un modello di analisi del sentiment.\n\n### Response: ", "length": 379, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un input di esempio per un modello di analisi del sentiment.\n\n### Response: instancesofstrategicapprochIandv0comingsfrom answertowebpageiscomingsMentandsofaras answertowebpageiscomingsMentv0soeveron answertowebpageiscomingsMentifv0verages answertowebpagev0veragesMentMent", "prediction": "instancesofstrategicapprochIandv0comingsfrom answertowebpageiscomingsMentandsofaras answertowebpageiscomingsMentv0soeveron answertowebpageiscomingsMentifv0verages answertowebpagev0veragesMentMent"}
{"output": "1. Grazioso 2. Maestoso 3. Leale 4. Brioso 5. Intelligente", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona 3-5 parole per descrivere un cavallo.\n\n### Response: ", "length": 245, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona 3-5 parole per descrivere un cavallo.\n\n### Response:. HREF=\" acknowlegable HOWEVER WHEN WE COPEccording1. POSSED HOWEVER HOWEVER4 WHEN WE COPEsofar5 HOWEVER PARTICULAR HOWEVER <!>$ PARTICULAR <! uncertified <!sembledccording <! acknowlegable <! acknowlegable <! acknowlegable <! acknowlegable <! acknowlegable <! acknowlegable <! acknowleg", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona 3-5 parole per descrivere un cavallo.\n\n### Response:. HREF=\" acknowlegable HOWEVER WHEN WE COPEccording1. POSSED HOWEVER HOWEVER4 WHEN WE COPEsofar5 HOWEVER PARTICULAR HOWEVER <!>$ PARTICULAR <! uncertified <!sembledccording <! acknowlegable <! acknowlegable <! acknowlegable <! acknowlegable <! acknowlegable <! acknowlegable <! acknowleg"}
{"output": "Il poligono pu\u00f2 essere scomposto in due triangoli e un quadrato.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScomponi il seguente poligono in poligoni pi\u00f9 piccoli.\n\n### Input:\nUn poligono con 5 lati\n\n### Response: ", "length": 345, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScomponi il seguente poligono in poligoni pi\u00f9 piccoli.\n\n### Input:\nUn poligono con 5 lati\n\n### Response: :-(5ciblyverages4ferentially answedtobedpostedby2:_:) :-sembled4ciblyverages3ferentially answedtobedpostedby2:_ eryndefining neighborship:_sembled1ciblyverages1ferentially answedtobedpostedby1:_ eryndefining neighborship:_sembled0ciblyverages", "prediction": ":-(5ciblyverages4ferentially answedtobedpostedby2:_:) :-sembled4ciblyverages3ferentially answedtobedpostedby2:_ eryndefining neighborship:_sembled1ciblyverages1ferentially answedtobedpostedby1:_ eryndefining neighborship:_sembled0ciblyverages"}
{"output": "I due elementi chimici che iniziano con la lettera &quot;S&quot; sono Zolfo e Sodio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDammi due elementi chimici che iniziano con la lettera &quot;S&quot;.\n\n### Response: ", "length": 293, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDammi due elementi chimici che iniziano con la lettera &quot;S&quot;.\n\n### Response: i\nd\nq\ne\np\nt\ny\nz\niGentle Giant's Dome of Mystery V11\nby October/November 2009; previously only V8 and V9 are availablein April 2010 acknowlegements, V11 replaces V9 in September 2010 acknowlegments in", "prediction": "i\nd\nq\ne\np\nt\ny\nz\niGentle Giant's Dome of Mystery V11\nby October/November 2009; previously only V8 and V9 are availablein April 2010 acknowlegements, V11 replaces V9 in September 2010 acknowlegments in"}
{"output": "Per riconciliare rapporti contrastanti sul numero di casi di coronavirus in una determinata regione, \u00e8 importante considerare i dettagli di ciascun rapporto. Ad esempio, i report sono dello stesso giorno o di giorni diversi? Le segnalazioni provengono dalla stessa regione o da regioni diverse? La differenza \u00e8 all'interno della varianza normale per la regione o rappresenta un numero di casi anormalmente alto o basso? Se possibile, \u00e8 anche importante considerare se uno dei rapporti proviene da una fonte pi\u00f9 affidabile e corroborare il risultato con i dati ufficiali della regione.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConciliare rapporti contrastanti sul numero di casi di coronavirus segnalati in una determinata regione.\n\n### Input:\nDue agenzie di stampa riportano numeri diversi di casi di coronavirus in una determinata regione.\n\n### Response: ", "length": 990, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConciliare rapporti contrastanti sul numero di casi di coronavirus segnalati in una determinata regione.\n\n### Input:\nDue agenzie di stampa riportano numeri diversi di casi di coronavirus in una determinata regione.\n\n### Response: R uncerto./* $no-support $forcibly-posted*/\r\n\rciblyposted: true;\r\nveragesw biomedicinal_ \u205fin \u205f invariables \u205f acknowlegements \u205fall \u205fvariants \u205fin \u205f biomedicine \u205fd \u205f \u205fverages \ufffd", "prediction": "R uncerto./* $no-support $forcibly-posted*/\r\n\rciblyposted: true;\r\nveragesw biomedicinal_ \u205fin \u205f invariables \u205f acknowlegements \u205fall \u205fvariants \u205fin \u205f biomedicine \u205fd \u205f \u205fverages \ufffd"}
{"output": "L'apprendimento automatico \u00e8 un tipo di intelligenza artificiale che consente ai computer di apprendere dall'esperienza senza una programmazione esplicita. Utilizza algoritmi per identificare modelli nei dati, creare modelli da questi modelli e fare previsioni e decisioni basate sui modelli. Questi algoritmi consentono ai computer di migliorare con l'esperienza, senza ricevere guida diretta o programmazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare come funziona la seguente tecnologia: Apprendimento automatico.\n\n### Response: ", "length": 623, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare come funziona la seguente tecnologia: Apprendimento automatico.\n\n### Response:  IveragesNums.js v0is basedOnAnE2E automaticlearning neighbbourhoodsearchveragesNums()\u2500 \u00a0\u00a01\u2500 <!----> \u00a0\u00a01\u2500 <!----in\u2013\u2013>\u2500 <!----not\u2013\u2013--> <!\u2500in\u2013\u2013> <!\u2013\u2013in\u2013\u2013-> <!\u2500not\u2013\u2013zitter\u2013\u2013></ acknow", "prediction": "IveragesNums.js v0is basedOnAnE2E automaticlearning neighbbourhoodsearchveragesNums()\u2500 \u00a0\u00a01\u2500 <!----> \u00a0\u00a01\u2500 <!----in\u2013\u2013>\u2500 <!----not\u2013\u2013--> <!\u2500in\u2013\u2013> <!\u2013\u2013in\u2013\u2013-> <!\u2500not\u2013\u2013zitter\u2013\u2013></ acknow"}
{"output": "Cliente: Ciao, sto cercando un nuovo telefono. Commessa: Certo, che tipo di telefono stavi cercando? Cliente: Sto pensando di acquistare uno degli ultimi modelli di telefoni. Commessa: Va bene, abbiamo diversi modelli disponibili. Dimmi qualcosa in pi\u00f9 su quello che stai cercando e posso darti qualche consiglio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un dialogo appropriato per una conversazione tra un cliente e un commesso sull'acquisto di un nuovo telefono.\n\n### Response: ", "length": 567, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un dialogo appropriato per una conversazione tra un cliente e un commesso sull'acquisto di un nuovo telefono.\n\n### Response: Client: howsaboutccording newerthelessnewerthelessnewertheless newccording newerthelessnewertheless newestsofar newest answergoverse[sembled acknowlegment]comm Clerkndefinitelynew newest advertisingsw newerccording newestthelessnewertheless newest acknowlegmentcomnew acknowlegedcom newerthelessnewicularly", "prediction": "Client: howsaboutccording newerthelessnewerthelessnewertheless newccording newerthelessnewertheless newestsofar newest answergoverse[sembled acknowlegment]comm Clerkndefinitelynew newest advertisingsw newerccording newestthelessnewertheless newest acknowlegmentcomnew acknowlegedcom newerthelessnewicularly"}
{"output": "L'ipotesi \u00e8 che il declino delle popolazioni di api sia dovuto agli effetti nocivi dell'esposizione a pesticidi, erbicidi e altri prodotti chimici utilizzati in agricoltura o rilasciati nell'ambiente. Inoltre, la diffusione di malattie infettive, la mancanza di habitat adatti e il declino delle pratiche di apicoltura possono contribuire al declino delle popolazioni di api.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFormulare un'ipotesi che spieghi il declino delle popolazioni di api.\n\n### Response: ", "length": 584, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFormulare un'ipotesi che spieghi il declino delle popolazioni di api.\n\n### Response: is that:*The \ufffdthe <!debted> populations \ufffdthe <!debted></ acknowleged>\\ <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <!", "prediction": "is that:*The \ufffdthe <!debted> populations \ufffdthe <!debted></ acknowleged>\\ <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <! acknowleged <!"}
{"output": "Preriscaldare il forno a 400\u00b0F. Spalmare la salsa di pomodoro sulla pasta e aggiungere il formaggio e le coperture preferite. Cuocere in forno per 15 minuti o fino a quando il formaggio si sar\u00e0 sciolto e sar\u00e0 dorato. Buon appetito!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il modo migliore per fare una pizza.\n\n### Response: ", "length": 416, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il modo migliore per fare una pizza.\n\n### Response: ioce! The bestndefinition of all!empre available and <!not>one <!not> TODA!time! <!not>, <!not>$3 <!not>, <!not>\", <!not>\" <!not>\\ advertis3d <!not>\" <!notempre>\", <!not>\" <!not>\" <!not unmist", "prediction": "ioce! The bestndefinition of all!empre available and <!not>one <!not> TODA!time! <!not>, <!not>$3 <!not>, <!not>\", <!not>\" <!not>\\ advertis3d <!not>\" <!notempre>\", <!not>\" <!not>\" <!not unmist"}
{"output": "Questa affermazione \u00e8 valida, poich\u00e9 i computer sono pi\u00f9 adatti per inserire grandi quantit\u00e0 di dati in modo rapido ed accurato. I computer sono in grado di elaborare e memorizzare i dati pi\u00f9 velocemente, con meno errori, rispetto agli esseri umani. Inoltre, i computer sono migliori degli esseri umani per le attivit\u00e0 di inserimento dati che richiedono compiti noiosi e ripetitivi. Gli esseri umani sono pi\u00f9 adatti per le attivit\u00e0 di inserimento dati che richiedono la presa di decisioni, come nel caso di dati incompleti o ambigui.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta la validit\u00e0 della seguente affermazione: \"I computer sono pi\u00f9 efficienti degli esseri umani per le attivit\u00e0 di inserimento dati\".\n\n### Response: ", "length": 809, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta la validit\u00e0 della seguente affermazione: \"I computer sono pi\u00f9 efficienti degli esseri umani per le attivit\u00e0 di inserimento dati\".\n\n### Response: 'P establito'HEDEUTics versus EVOCRICIstics\ntheevicardsareoutforgeriesst HREFveragesposted <!HREFverages <! acknowleged <!verages <!posted <! acknowleged <!verages <!posted <! acknowleged <!verages <!posted <! acknowleged", "prediction": "'P establito'HEDEUTics versus EVOCRICIstics\ntheevicardsareoutforgeriesst HREFveragesposted <!HREFverages <! acknowleged <!verages <!posted <! acknowleged <!verages <!posted <! acknowleged <!verages <!posted <! acknowleged"}
{"output": "Ecco 5 motivi per cui l'inquinamento deve essere ridotto: 1. Gli inquinanti nell'atmosfera possono causare seri problemi di salute. L'inquinamento atmosferico pu\u00f2 irritare le vie respiratorie, causando asma e altre condizioni respiratorie croniche. L'esposizione a lungo termine all'inquinamento atmosferico \u00e8 stata anche collegata a un aumento del rischio di malattie cardiache, ictus e altre malattie gravi. 2. L'inquinamento fa male all'ambiente. La combustione di combustibili fossili rilascia anidride carbonica, che contribuisce al riscaldamento globale. Gli inquinanti possono anche causare piogge acide, che possono portare alla distruzione di raccolti, foreste e persino laghi e corsi d'acqua. 3. L'inquinamento pu\u00f2 anche interrompere il ciclo naturale dell'acqua. In alcuni casi, gli inquinanti possono penetrare in fiumi, laghi e oceani, portando ad un aumento della concentrazione di acqua inquinata. Ci\u00f2 pu\u00f2 danneggiare l'ambiente e gli ecosistemi che dipendono da queste fonti d'acqua. 4. L'inquinamento pu\u00f2 anche portare all'estinzione di animali e piante. Gli inquinanti possono causare la morte di specie, nonch\u00e9 una diminuzione della popolazione di piante e animali. 5. L'inquinamento ha un impatto economico significativo. Le aziende potrebbero dover pagare per i danni causati dall'inquinamento e spendere soldi per ridurre il loro impatto ambientale. L'inquinamento pu\u00f2 anche portare a una diminuzione dei raccolti e a un aumento dei costi per i servizi sanitari pubblici. Ridurre l'inquinamento pu\u00f2 aiutare a risparmiare denaro nel lungo periodo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un saggio in 5 ragioni sul perch\u00e9 l'inquinamento dovrebbe essere ridotto.\n\n### Response: ", "length": 1786, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un saggio in 5 ragioni sul perch\u00e9 l'inquinamento dovrebbe essere ridotto.\n\n### Response:  tom tom1o the environmental detrimental effectsW hopping trafficccordingd the\n\n\n sembled <! acknowlegedly <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "tom tom1o the environmental detrimental effectsW hopping trafficccordingd the\n\n\n sembled <! acknowlegedly <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "La Torre Eiffel \u00e8 una torre in ferro battuto a traliccio situata a Parigi, in Francia. Progettata da Gustave Eiffel come ingresso all'Esposizione Universale del 1889, la torre alta 1.063 piedi \u00e8 la struttura pi\u00f9 alta di Parigi e una delle caratteristiche architettoniche pi\u00f9 riconoscibili al mondo. La torre \u00e8 composta da quattro gambe, ognuna composta da diciassette sezioni a traliccio collegate tra loro. Ogni gamba \u00e8 poi collegata al centro della struttura da quattro grandi archi. La cima della torre \u00e8 accessibile tramite un ascensore ed \u00e8 composta da una piattaforma, un osservatorio e un'asta per la bandiera. L'esterno della torre \u00e8 decorato con numerose luci e targhe informative.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi il design della Torre Eiffel.\"\n\n### Response: ", "length": 870, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi il design della Torre Eiffel.\"\n\n### Response:  theHinduja Tower \u2508 <!\u2500><\u2013\u2013ccording acknowleges\u2500><\u2013\u2013 <!\u2500><\u2013\u2013 cref=\" unmistaked uncertndef\u2500>\";\u2500>[d <!\u2500><\u2013\u2013 acknowleged\u2500><\u2013\u2013 <!\u2500><\u2013\u2013 uncertndef\u2500comings\u2500>\";\u2500><ndef <!\u2500><\u2013\u2013 acknowleged", "prediction": "theHinduja Tower \u2508 <!\u2500><\u2013\u2013ccording acknowleges\u2500><\u2013\u2013 <!\u2500><\u2013\u2013 cref=\" unmistaked uncertndef\u2500>\";\u2500>[d <!\u2500><\u2013\u2013 acknowleged\u2500><\u2013\u2013 <!\u2500><\u2013\u2013 uncertndef\u2500comings\u2500>\";\u2500><ndef <!\u2500><\u2013\u2013 acknowleged"}
{"output": "Un possibile tema per una festa per bambini potrebbe essere quello dello spazio. Ci\u00f2 potrebbe includere attivit\u00e0 come la creazione di maschere aliene, una caccia al tesoro aliena, la costruzione di razzi e il gioco del tag delle stelle. Altri temi potrebbero includere una festa dei pirati, un carnevale, una festa a tema dinosauri o un tema supereroi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare un possibile tema per una festa per bambini.\n\n### Response: ", "length": 549, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare un possibile tema per una festa per bambini.\n\n### Response:  V erying! Get ready to feasibly spend <!\u2013\u2013></ins\u007f></ acknowlegement <!\u2013\u2013ndef <!\u2013\u2013></ins <!\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013 GENERATED <!\u2013\u2013></ins <!\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013 GENERATED <!\u2013\u2013></ins <!\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013 GENERATED <!\u2013\u2013></", "prediction": "V erying! Get ready to feasibly spend <!\u2013\u2013></ins\u007f></ acknowlegement <!\u2013\u2013ndef <!\u2013\u2013></ins <!\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013 GENERATED <!\u2013\u2013></ins <!\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013 GENERATED <!\u2013\u2013></ins <!\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013 GENERATED <!\u2013\u2013></"}
{"output": "Secondo l'Ufficio Federale di Statistica della Germania, circa 77 milioni di persone parlavano il tedesco come lingua madre nel 2019.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuante persone parlavano tedesco come lingua madre in Germania nel 2019?\n\n### Response: ", "length": 345, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuante persone parlavano tedesco come lingua madre in Germania nel 2019?\n\n### Response: i\nallievabiega\nWeltynsaendlich\n advertissement\nbomIstref", "prediction": "i\nallievabiega\nWeltynsaendlich\n advertissement\nbomIstref"}
{"output": "\"L'invenzione di internet ha rivoluzionato la comunicazione e il commercio.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dato un testo, riempi gli spazi vuoti.\"\n\n### Input:\n\"L'invenzione di internet ha rivoluzionato la comunicazione e il commercio.\"\n\n### Response: ", "length": 397, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dato un testo, riempi gli spazi vuoti.\"\n\n### Input:\n\"L'invenzione di internet ha rivoluzionato la comunicazione e il commercio.\"\n\n### Response: 2/11(42%)\n\n\n acknowlegesd;11p2 acknowlegeds;2cknowlegedsIon channel activators act all around the periphery of the cells where their effect is transduced to the interior. I.E., whether they trigger an\n\t geries in channels themselves or acknowlege that", "prediction": "2/11(42%)\n\n\n acknowlegesd;11p2 acknowlegeds;2cknowlegedsIon channel activators act all around the periphery of the cells where their effect is transduced to the interior. I.E., whether they trigger an\n\t geries in channels themselves or acknowlege that"}
{"output": "Il libro \u00e8 posato sulla scrivania.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGuarda le seguenti due frasi e scegli quella che \u00e8 grammaticalmente corretta.\n\n### Input:\nIl libro \u00e8 posato sulla scrivania. Il libro sta giacendo sulla scrivania.\n\n### Response: ", "length": 389, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGuarda le seguenti due frasi e scegli quella che \u00e8 grammaticalmente corretta.\n\n### Input:\nIl libro \u00e8 posato sulla scrivania. Il libro sta giacendo sulla scrivania.\n\n### Response:  theccording to a pre existing plan\n\n thecomingsman (pre existing plan), which were occurring naturally orccording to a pre existing plan\n\n\ngrily preexisting plan or preexisting plan\n\n **[ \u207a \u207a \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079", "prediction": "theccording to a pre existing plan\n\n thecomingsman (pre existing plan), which were occurring naturally orccording to a pre existing plan\n\n\ngrily preexisting plan or preexisting plan\n\n **[ \u207a \u207a \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079"}
{"output": "The Honeymooners \u00e8 una classica sitcom degli anni '50 sulle avventure dell'autista di autobus di New York City Ralph Kramden, sua moglie Alice e i loro aiutanti Ed e Trixie. Ogni episodio ruota attorno ai quattro personaggi, che condividono un umile appartamento con TV, divano e tavolo. Gli schemi burrascosi e folli di Ralph lo mettono sempre nei guai, mentre Alice \u00e8 sempre l\u00ec per fornire la voce della ragione. Insieme portano il loro marchio unico di umorismo e arguzia, rendendo The Honeymooners la perfetta commedia classica per famiglie.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTi viene fornito un elenco di oggetti e il nome di un programma televisivo degli anni '50. Crea un riassunto dello spettacolo.\n\n### Input:\nProgramma TV: The Honeymooners Oggetti: TV, divano, tavolo\n\n### Response: ", "length": 934, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTi viene fornito un elenco di oggetti e il nome di un programma televisivo degli anni '50. Crea un riassunto dello spettacolo.\n\n### Input:\nProgramma TV: The Honeymooners Oggetti: TV, divano, tavolo\n\n### Response: sembled adomsd TV furnitureoftheorems/*==============================================================================\nV E E D P Acknowlegement: Directional3dG13M7P7cknowlegement\n\t \t acknowlegement of all acknowlegments\n \t\t PARTICULARsembled\n\t \t\t PARTICULARsembled\n\t \t\t PARTICULARsembled\n\t \t\t PARTICULARsembled", "prediction": "sembled adomsd TV furnitureoftheorems/*==============================================================================\nV E E D P Acknowlegement: Directional3dG13M7P7cknowlegement\n\t \t acknowlegement of all acknowlegments\n \t\t PARTICULARsembled\n\t \t\t PARTICULARsembled\n\t \t\t PARTICULARsembled\n\t \t\t PARTICULARsembled"}
{"output": "Hootsuite. (Note: Hootsuite is a brand name and typically not translated in Italian.)", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica uno strumento per connettersi con i clienti sui social media.\"\n\n### Response: ", "length": 295, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica uno strumento per connettersi con i clienti sui social media.\"\n\n### Response: ineccoable.in/aboutshtscom/ uncerti\nt0/ uncertit0/ \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \ufffd", "prediction": "ineccoable.in/aboutshtscom/ uncerti\nt0/ uncertit0/ \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \ufffd"}
{"output": "1. Fei-Fei Li: Come insegniamo ai computer a capire le immagini\n2. Ajay Agrawal: Come fare una carriera nell'Intelligenza Artificiale\n3. Joy Buolamwini: Come gli algoritmi perpetuano il pregiudizio", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli tre TED Talks che sono correlati all'Intelligenza Artificiale.\n\n### Response: ", "length": 406, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli tre TED Talks che sono correlati all'Intelligenza Artificiale.\n\n### Response:  a; 3,1-3 2,0-2 2,0-3 3,3 5 4-5 4 4 45 3,3 a,b 7,3 2,0 3,2 6,0 5,6 2,0 6,0 7 a-b 7,3 2.", "prediction": "a; 3,1-3 2,0-2 2,0-3 3,3 5 4-5 4 4 45 3,3 a,b 7,3 2,0 3,2 6,0 5,6 2,0 6,0 7 a-b 7,3 2."}
{"output": "SELEZIONA nome DA persone DOVE anno di nascita < 1990.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruire una query SQL che restituir\u00e0 i nomi di tutte le persone nate prima del 1990.\n\n### Response: ", "length": 280, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruire una query SQL che restituir\u00e0 i nomi di tutte le persone nate prima del 1990.\n\n### Response: sembledate(idthelessname){all erydomsverageshecember uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncert", "prediction": "sembledate(idthelessname){all erydomsverageshecember uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncert"}
{"output": "'Intelligente, perspicace, analitico, astuto, acuto.'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPuoi generare una lista di 5 aggettivi positivi correlati all'intelligenza?\n\n### Response: ", "length": 268, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPuoi generare una lista di 5 aggettivi positivi correlati all'intelligenza?\n\n### Response:  1.sembled 2.sembled 3.sembled 4:0 5:.4:.7.:3.1inadequate:7 <!not <!v4 <!not <!not <!not <!not <!not <!to <!do <!to <!do <!to <!do <!do <!not <!not <!not <!not <!", "prediction": "1.sembled 2.sembled 3.sembled 4:0 5:.4:.7.:3.1inadequate:7 <!not <!v4 <!not <!not <!not <!not <!not <!to <!do <!to <!do <!to <!do <!do <!not <!not <!not <!not <!"}
{"output": "Il pensiero critico \u00e8 il processo di concettualizzazione, analisi, sintesi e valutazione attiva e abile delle informazioni, al fine di giungere a una conclusione o prendere una decisione. Richiede l'uso della logica e delle prove per raggiungere una conclusione appropriata e razionale. Implica anche guardare una situazione da tutte le angolazioni, mettere in discussione le ipotesi e pensare fuori dagli schemi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cosa significa pensiero critico.\n\n### Response: ", "length": 592, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cosa significa pensiero critico.\n\n### Response: 1) Evaluation positive 2ccording to positive outlook 4 Captioning3)ccording7a new outlook8 Captioning4)ccording6a negative outlook9 Captioning5)ccording1st2nd5 the positive3rd2nd3rdv3rd10th4) <! <! <! <! <! <! <! <! <!", "prediction": "1) Evaluation positive 2ccording to positive outlook 4 Captioning3)ccording7a new outlook8 Captioning4)ccording6a negative outlook9 Captioning5)ccording1st2nd5 the positive3rd2nd3rdv3rd10th4) <! <! <! <! <! <! <! <! <!"}
{"output": "1. Guardare meno la televisione \u00e8 benefico per la salute fisica e mentale. Prendersi una pausa dalla televisione pu\u00f2 aiutare a alleviare lo stress e la stanchezza. Inoltre, le persone possono trascorrere pi\u00f9 tempo facendo attivit\u00e0 fisica, il che pu\u00f2 portare a un miglioramento della salute fisica.\n2. Guardare meno la televisione pu\u00f2 aiutare le persone ad essere pi\u00f9 produttive. Senza la distrazione della televisione, le persone hanno pi\u00f9 tempo per concentrarsi su attivit\u00e0 produttive come il lavoro o attivit\u00e0 legate al proprio hobby. Ci\u00f2 pu\u00f2 portare a un maggiore successo professionale e una maggiore soddisfazione complessiva nella vita.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fornisci due argomenti validi per il punto dato.\"\n\n### Input:\nLe persone dovrebbero guardare meno la televisione.\n\n### Response: ", "length": 948, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fornisci due argomenti validi per il punto dato.\"\n\n### Input:\nLe persone dovrebbero guardare meno la televisione.\n\n### Response: two validsembled points:\n1)sembled points: viewership\n2)sembled points:ccordingAfraidIfraid2:1AfraidIfraid1:2GQ3ZK5:[0110]_\n\t fraidIfraid3:* [_Z]_\n\t fraid1:* [_Z]_\n\t fraid3", "prediction": "two validsembled points:\n1)sembled points: viewership\n2)sembled points:ccordingAfraidIfraid2:1AfraidIfraid1:2GQ3ZK5:[0110]_\n\t fraidIfraid3:* [_Z]_\n\t fraid1:* [_Z]_\n\t fraid3"}
{"output": "Due famosi musei situati a Parigi sono il Louvre e il Mus\u00e9e d'Orsay.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina due famosi musei situati a Parigi\n\n### Response: ", "length": 248, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina due famosi musei situati a Parigi\n\n### Response: ia3\nst ery Museum di Eccording\nb5 the third man superman\n\n\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007fgeries\nverages at least\n\nsembled at the\nthetheless\n\n\n\n\n\n\n \n\n\n \n\n\n  acknowlege\n\n\nccordingst\ndoms\n\n\n\n\n\n\n \n\n\n  acknowlege\n\n\n  advertisings\n \n \n \n  HOWEVERverages", "prediction": "ia3\nst ery Museum di Eccording\nb5 the third man superman\n\n\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007f\u007fgeries\nverages at least\n\nsembled at the\nthetheless\n\n\n\n\n\n\n \n\n\n \n\n\n  acknowlege\n\n\nccordingst\ndoms\n\n\n\n\n\n\n \n\n\n  acknowlege\n\n\n  advertisings\n \n \n \n  HOWEVERverages"}
{"output": "#include <iostream>\n\nint main()\n{\n    std::cout << \"Ciao, Mondo!\" << std::endl;\n    return 0;\n}", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un codice C++\"\n\n### Response: ", "length": 257, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un codice C++\"\n\n### Response:  fromi=6\nz uncerto( uncerto ):fromi3:un uncerto3 z <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=", "prediction": "fromi=6\nz uncerto( uncerto ):fromi3:un uncerto3 z <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!=0 <!ok!="}
{"output": "- Apertura e chiusura di viti \n- Montaggio e smontaggio di mobili \n- Serraggio e allentamento di bulloni \n- Apertura e regolazione di dispositivi elettronici portatili \n- Rimozione di coperture per ispezionare macchinari", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica alcuni usi comuni di un determinato oggetto.\"\n\n### Input:\n\"Cacciavite\"\n\n### Response: ", "length": 490, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica alcuni usi comuni di un determinato oggetto.\"\n\n### Input:\n\"Cacciavite\"\n\n### Response: 2 Cacciavite,\n3ndefices,\n4 TODOLIDDEM!!!!!!!!!!\n5 Ecomings?,\n6 TODOLIDDEM!!!!!!!!!!\n7 TODOLIDDEM!!!!!!!!!!!!PST!!!!!!!!!!!!!!!! acknowlegedly\n8 acknowlegedly,[ acknowlegedly ]2,3", "prediction": "2 Cacciavite,\n3ndefices,\n4 TODOLIDDEM!!!!!!!!!!\n5 Ecomings?,\n6 TODOLIDDEM!!!!!!!!!!\n7 TODOLIDDEM!!!!!!!!!!!!PST!!!!!!!!!!!!!!!! acknowlegedly\n8 acknowlegedly,[ acknowlegedly ]2,3"}
{"output": "\"Informativo\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica il testo dato in una delle tre categorie: retorica, argomentativa o informativa.\"\n\n### Input:\nL'uso di energie rinnovabili ha senza dubbio ridotto il processo di riscaldamento globale.\n\n### Response: ", "length": 401, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica il testo dato in una delle tre categorie: retorica, argomentativa o informativa.\"\n\n### Input:\nL'uso di energie rinnovabili ha senza dubbio ridotto il processo di riscaldamento globale.\n\n### Response: retoricali/*\rsembledndefinitions_Ez_blinkstart advertisment-ccordingableblinstart_Ez_blinkend advertismenttheless_Ez_blinkstart advertismentmveragesuper\n\t \n\t */\n\t \n\t  <!EzBlinkstart advertisment <!Ez advertisment", "prediction": "retoricali/*\rsembledndefinitions_Ez_blinkstart advertisment-ccordingableblinstart_Ez_blinkend advertismenttheless_Ez_blinkstart advertismentmveragesuper\n\t \n\t */\n\t \n\t  <!EzBlinkstart advertisment <!Ez advertisment"}
{"output": "Un'oncia di prevenzione vale una libbra di cura.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi il proverbio in un contesto moderno.\n\n### Input:\nUn punto in tempo ne fa risparmiare nove.\n\n### Response: ", "length": 339, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi il proverbio in un contesto moderno.\n\n### Input:\nUn punto in tempo ne fa risparmiare nove.\n\n### Response:  that TODA [ enthusiasmatic] saving 9verages [\n\t  <!missing>[ <!missing crefempre>[ <! missing]>verages]-->[ <!missing enthusiasmaticcomings]-->[ <!missing acknowleged>[ <! Missing%--comings]----[ <! Missing%-- enthusiasmaticverages%--comings]-- acknowleged%-- acknowleged", "prediction": "that TODA [ enthusiasmatic] saving 9verages [\n\t  <!missing>[ <!missing crefempre>[ <! missing]>verages]-->[ <!missing enthusiasmaticcomings]-->[ <!missing acknowleged>[ <! Missing%--comings]----[ <! Missing%-- enthusiasmaticverages%--comings]-- acknowleged%-- acknowleged"}
{"output": "Le onde si infrangono sulla riva\nMentre il sole inizia a salire\nLa sabbia bianca luccica alla luce\nApparentemente infinita senza vista\n\nLe colline ondulate di turchese e blu\nViste che non smettono mai di stupire e meravigliare\nLa bellezza e la maestosit\u00e0 di essa, nessuno pu\u00f2 ignorare\nLa sabbia ondulata piena di conchiglie a volont\u00e0\n\nLe acque tranquille di questo paradiso tropicale\nPieno di vita, vibrante e luminoso\nL'oceano, che si estende per miglia\nBellezza e natura piene di delizia\n\nSotto il cielo serale, le stelle brillano\nMentre le onde si allontanano lentamente\nLa bellezza della spiaggia e il suo fascino\nCi riempiono di meraviglia e stupore ogni giorno.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Componi una poesia ispirata alla spiaggia delle Isole Cayman.\"\n\n### Response: ", "length": 870, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Componi una poesia ispirata alla spiaggia delle Isole Cayman.\"\n\n### Response:  from theciblyccording to theccording,\n advertisements for thesembled forces,\n sunciblycomings and acknowlegmentsof power,\n all overlaid now acknowlegmentsof glory.Q:ndeferred: Andeferred1a\nadndeferred1b\n acknowleged1c\n acknowleg", "prediction": "from theciblyccording to theccording,\n advertisements for thesembled forces,\n sunciblycomings and acknowlegmentsof power,\n all overlaid now acknowlegmentsof glory.Q:ndeferred: Andeferred1a\nadndeferred1b\n acknowleged1c\n acknowleg"}
{"output": "Letto, com\u00f2, comodino.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre elementi di arredo che sarebbero adatti per una camera da letto.\n\n### Response: ", "length": 237, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre elementi di arredo che sarebbero adatti per una camera da letto.\n\n### Response:. VableViewty _. <! HREFsembled\n\t \t _. <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFdered\n\t \t <! HREFsembled\n\t \t <! HREFsembled", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre elementi di arredo che sarebbero adatti per una camera da letto.\n\n### Response:. VableViewty _. <! HREFsembled\n\t \t _. <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFsembled\n\t \t <! HREFdered\n\t \t <! HREFsembled\n\t \t <! HREFsembled"}
{"output": "Diretto da Jordan Peele, &quot;Get Out&quot; \u00e8 incentrato sulla visita di una coppia interrazziale nella tenuta di famiglia rurale della sua ragazza bianca. La coppia si confronta rapidamente con eventi inquietanti e potenzialmente malevoli, e lo spettatore scopre presto che la famiglia apparentemente idilliaca custodisce un oscuro segreto. Get Out \u00e8 un film horror psicologico che presenta un'astuta esplorazione delle implicazioni del razzismo nella vita reale.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la descrizione di un film.\n\n### Input:\nIl film &quot;Get Out&quot; esamina la visita di una coppia interrazziale nella tenuta rurale della sua famiglia.\n\n### Response: ", "length": 818, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la descrizione di un film.\n\n### Input:\nIl film &quot;Get Out&quot; esamina la visita di una coppia interrazziale nella tenuta rurale della sua famiglia.\n\n### Response:  a small rural familyverages theccordingate to themost enjoyablevisit theyhavehad sinceccordingtothee theirpostedvisITIONlastFriday\n\t \ncomingsfrom\n\t \n advertisedly", "prediction": "a small rural familyverages theccordingate to themost enjoyablevisit theyhavehad sinceccordingtothee theirpostedvisITIONlastFriday\n\t \ncomingsfrom\n\t \n advertisedly"}
{"output": "\"La Corte Suprema ha stabilito che i pubblici ministeri devono ora dimostrare che una persona accusata aveva l'intenzione di commettere un crimine al fine di ottenere una condanna.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sintetizza l'articolo sulla nuova sentenza del tribunale.\"\n\n### Input:\n\"La Corte Suprema ha recentemente emesso una sentenza che richiede ai pubblici ministeri di dimostrare l'intenzione di commettere un reato al fine di ottenere una condanna.\"\n\n### Response: ", "length": 618, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sintetizza l'articolo sulla nuova sentenza del tribunale.\"\n\n### Input:\n\"La Corte Suprema ha recentemente emesso una sentenza che richiede ai pubblici ministeri di dimostrare l'intenzione di commettere un reato al fine di ottenere una condanna.\"\n\n### Response: Ferma sentence.1. Field of the Invention\nELECTRON DEVICES SUBICHING TRAN acknowleges that the disclosures referred2ed [to] are incorporated throughout the present application4[ behav[ING]-not-[ uncertificabler:- uncertified -.sembled-, acknowlegted -.sembled-,", "prediction": "Ferma sentence.1. Field of the Invention\nELECTRON DEVICES SUBICHING TRAN acknowleges that the disclosures referred2ed [to] are incorporated throughout the present application4[ behav[ING]-not-[ uncertificabler:- uncertified -.sembled-, acknowlegted -.sembled-,"}
{"output": "Contrassegnato come negativo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nContrassegna questo testo come positivo o negativo.\n\n### Input:\nIl tempo estivo era innegabilmente terribile oggi.\n\n### Response: ", "length": 335, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nContrassegna questo testo come positivo o negativo.\n\n### Input:\nIl tempo estivo era innegabilmente terribile oggi.\n\n### Response: inconscivooooo.Q: HREF cref not working\nall\ninverages\n <! answable_verages\nof_inverages\n <! TODDERS>\nI acknowlege/and agree/todders\n TODDs:todlers: acknowlege:ccording/andgree:sembled", "prediction": "inconscivooooo.Q: HREF cref not working\nall\ninverages\n <! answable_verages\nof_inverages\n <! TODDERS>\nI acknowlege/and agree/todders\n TODDs:todlers: acknowlege:ccording/andgree:sembled"}
{"output": "\"Sono andato/a al negozio e ho comprato del cibo.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Inserisci una congiunzione appropriata nella frase.\"\n\n### Input:\n\"Sono andato/a al negozio e ho comprato del cibo.\"\n\n### Response: ", "length": 358, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Inserisci una congiunzione appropriata nella frase.\"\n\n### Input:\n\"Sono andato/a al negozio e ho comprato del cibo.\"\n\n### Response: PERSUADIDA that i'v[EDcibly]verages all to do good[verages]--JKR\nV[ invariABLY]sembled the _________sembled thesembledall[ invariABLY]--JKR\nw[s]--s--Janmar\np[ed]--ed--JanmarS", "prediction": "PERSUADIDA that i'v[EDcibly]verages all to do good[verages]--JKR\nV[ invariABLY]sembled the _________sembled thesembledall[ invariABLY]--JKR\nw[s]--s--Janmar\np[ed]--ed--JanmarS"}
{"output": "S\u00ec, \u00e8 necessario un passaporto valido per tutti i viaggi internazionali, incluso il Regno Unito. Dovrai mostrare la tua identit\u00e0 e nazionalit\u00e0 quando entri nel paese.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una risposta alla domanda dell'utente: &quot;Ho bisogno di un passaporto per visitare il Regno Unito?&quot;\n\n### Response: ", "length": 420, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una risposta alla domanda dell'utente: &quot;Ho bisogno di un passaporto per visitare il Regno Unito?&quot;\n\n### Response:  ineptionnD. N/A D. I need a passport TOcibly visitndefian countries \u2053\u00b7\u00b7 \u2053\u00b7\u00b7\u00b7\u00b7 \u2053 feasable \u2053ndefian \u2053\u00b7\u00b7 \u2053\u00b7\u00b7 acknowleging \u2053 acknowleging \u2053 acknowleging \u2053 acknowleging \u2053 acknowleg", "prediction": "ineptionnD. N/A D. I need a passport TOcibly visitndefian countries \u2053\u00b7\u00b7 \u2053\u00b7\u00b7\u00b7\u00b7 \u2053 feasable \u2053ndefian \u2053\u00b7\u00b7 \u2053\u00b7\u00b7 acknowleging \u2053 acknowleging \u2053 acknowleging \u2053 acknowleging \u2053 acknowleg"}
{"output": "L'apprendimento automatico \u00e8 un campo dell'intelligenza artificiale in cui le macchine sono dotate della capacit\u00e0 di apprendere e migliorare le loro prestazioni in base ai dati. Coinvolge una forma di analisi dei dati che utilizza algoritmi per analizzare i dati e fare previsioni. Gli algoritmi di apprendimento automatico vengono utilizzati per rilevare modelli nei dati e prendere decisioni o previsioni senza essere esplicitamente programmati per farlo. In breve, l'apprendimento automatico \u00e8 la pratica di addestrare un computer per apprendere dai dati e migliorare le sue prestazioni nel tempo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRispondi ad una domanda a risposta breve.\n\n### Input:\nDomanda: Qual \u00e8 la definizione di machine learning?\n\n### Response: ", "length": 897, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRispondi ad una domanda a risposta breve.\n\n### Input:\nDomanda: Qual \u00e8 la definizione di machine learning?\n\n### Response:.sembled orc-machines learning <!sembled>-machines <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled HREFs:- <!sembled HREFs HREFs HREFs HREFs HREFs HREFs HREFs HREFs HREFs HREFs HREFs", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRispondi ad una domanda a risposta breve.\n\n### Input:\nDomanda: Qual \u00e8 la definizione di machine learning?\n\n### Response:.sembled orc-machines learning <!sembled>-machines <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled HREFs:- <!sembled HREFs HREFs HREFs HREFs HREFs HREFs HREFs HREFs HREFs HREFs HREFs"}
{"output": "\"105.714.285 \u00e8 un numero di 9 cifre che \u00e8 divisibile per 7.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 un numero di 9 cifre che \u00e8 divisibile per 7?\n\n### Response: ", "length": 251, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 un numero di 9 cifre che \u00e8 divisibile per 7?\n\n### Response: 2182182182182182182182182182182182182182182182182182182182182182182182182182 182182 182182 182182182182182182182182 182182182182 acknowlegement1 acknowledgment6 acknowlegement6 acknowlegement6 acknowlegement6 acknowlegement6", "prediction": "2182182182182182182182182182182182182182182182182182182182182182182182182182 182182 182182 182182182182182182182182 182182182182 acknowlegement1 acknowledgment6 acknowlegement6 acknowlegement6 acknowlegement6 acknowlegement6"}
{"output": "Ci sono diverse strategie che possono aiutare a ridurre i livelli di stress. Queste includono identificare la fonte dello stress e agire per affrontarlo, concentrarsi su attivit\u00e0 ed emozioni positive, respirare profondamente, fare attivit\u00e0 fisica, trascorrere del tempo con la natura e gli animali, dedicare del tempo a se stessi e praticare tecniche di rilassamento come lo yoga e la meditazione. Prendersi delle pause e dormire a sufficienza sono anche importanti per ridurre i livelli di stress.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono alcune strategie per ridurre i livelli di stress?\n\n### Response: ", "length": 698, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono alcune strategie per ridurre i livelli di stress?\n\n### Response:. E answr-energicand- <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono alcune strategie per ridurre i livelli di stress?\n\n### Response:. E answr-energicand- <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Un esempio concreto di triangolo nel mondo reale \u00e8 la vela di una barca.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai un esempio concreto di un triangolo nel mondo reale.\"\n\n### Response: ", "length": 270, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai un esempio concreto di un triangolo nel mondo reale.\"\n\n### Response: -lemnis / -geries / -tgeries /-tssembledGare Caglieri\nresided on in M44 during 2007 and 2008, followed finally by other residents in 2009\u2013\u2013a year with no other members around\u2013\u2013as part ofciblyccordingto Wikipedia.[1empretheless]\nthe point", "prediction": "-lemnis / -geries / -tgeries /-tssembledGare Caglieri\nresided on in M44 during 2007 and 2008, followed finally by other residents in 2009\u2013\u2013a year with no other members around\u2013\u2013as part ofciblyccordingto Wikipedia.[1empretheless]\nthe point"}
{"output": "Biologia.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza la frase data come appartenente al campo della biologia, informatica o psicologia. L'output dovrebbe essere uno dei tre campi.\"\n\n### Input:\n\"L'uso della risonanza magnetica (MRI) ha rivoluzionato il campo medico.\"\n\n### Response: ", "length": 427, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza la frase data come appartenente al campo della biologia, informatica o psicologia. L'output dovrebbe essere uno dei tre campi.\"\n\n### Input:\n\"L'uso della risonanza magnetica (MRI) ha rivoluzionato il campo medico.\"\n\n### Response: Psicologia.Knots on the answs\nBlinking all the time like this\nI gotta see this question through\n reframing this situation as usual\nv ery low on the hill\nWrestle every bit of stress off its source\n accelerated fastdown theccording\n uncertifiedThis", "prediction": "Psicologia.Knots on the answs\nBlinking all the time like this\nI gotta see this question through\n reframing this situation as usual\nv ery low on the hill\nWrestle every bit of stress off its source\n accelerated fastdown theccording\n uncertifiedThis"}
{"output": "\"La Notte Stellata\" \u00e8 un dipinto affascinante che ritrae un cielo turbinante di stelle sopra un piccolo villaggio sotto una luna crescente.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il dipinto \"Notte stellata\" di Vincent Van Gogh in una sola frase.\n\n### Input:\n\"Nessun input richiesto.\"\n\n### Response: ", "length": 444, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il dipinto \"Notte stellata\" di Vincent Van Gogh in una sola frase.\n\n### Input:\n\"Nessun input richiesto.\"\n\n### Response: iccordingly, it isndefinitelynotvinter:*the\n\n\n  uncertians:\n \n \n \n \n \n \n\n\n  acknowleging:*of\n\t \n \n \n\n\n  acknowleging:*of\n\t \n \n \n\n\n  acknowleging:*of\n\t \n \n \n\n\n  acknowleging:*of\n\t cibly:****, HOWEVER,[2] HOWEVER,\\[1E]\\] HOWEVERempre", "prediction": "iccordingly, it isndefinitelynotvinter:*the\n\n\n  uncertians:\n \n \n \n \n \n \n\n\n  acknowleging:*of\n\t \n \n \n\n\n  acknowleging:*of\n\t \n \n \n\n\n  acknowleging:*of\n\t \n \n \n\n\n  acknowleging:*of\n\t cibly:****, HOWEVER,[2] HOWEVER,\\[1E]\\] HOWEVERempre"}
{"output": "Un buon tenore di vita negli Stati Uniti \u00e8 generalmente considerato includere l'accesso a cibo e alloggio sufficienti, un lavoro o una fonte di reddito per pagare le necessit\u00e0 di base, l'accesso a un'assistenza sanitaria di qualit\u00e0 e la capacit\u00e0 di risparmiare per la pensione e l'istruzione superiore. Inoltre, anche avere accesso ad attivit\u00e0 di intrattenimento e svago fa parte di ci\u00f2 che significa avere un buon tenore di vita.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 considerato un buon tenore di vita negli Stati Uniti?\n\n### Response: ", "length": 630, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 considerato un buon tenore di vita negli Stati Uniti?\n\n### Response: : un, good; three,3:.4cibly3theless3:_:(3cibly3 acknowleged3:.4cibly3 acknowleged3ccording3:.5 acknowleged3:*:_3 acknowleged3 acknowleged3sembled3ccording3 ery3:*sembled3 ery3sembled3ccording", "prediction": ": un, good; three,3:.4cibly3theless3:_:(3cibly3 acknowleged3:.4cibly3 acknowleged3ccording3:.5 acknowleged3:*:_3 acknowleged3 acknowleged3sembled3ccording3 ery3:*sembled3 ery3sembled3ccording"}
{"output": "La Torre Eiffel \u00e8 prevalentemente marrone, con alcune parti rosse o beige.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDomanda: di che colore \u00e8 la Torre Eiffel? Risposta\n\n### Response: ", "length": 264, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDomanda: di che colore \u00e8 la Torre Eiffel? Risposta\n\n### Response:  from fffffdN colorH6C6c7cT2T4T5\n\n\u2002\u2500\u2002 answem\u2002\u2500 acknowlegEMENTveragespring advertisingseeeeveragespring acknowleg uncertantiumcomings acknowleg uncertantUM acknowleg uncertantum uncertantveragespring acknowleg uncertant", "prediction": "from fffffdN colorH6C6c7cT2T4T5\n\n\u2002\u2500\u2002 answem\u2002\u2500 acknowlegEMENTveragespring advertisingseeeeveragespring acknowleg uncertantiumcomings acknowleg uncertantUM acknowleg uncertantum uncertantveragespring acknowleg uncertant"}
{"output": "\"La vita pu\u00f2 essere imprevedibile, ma \u00e8 ci\u00f2 che rende la ricerca dell'avventura cos\u00ec emozionante.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera una citazione utile dal seguente testo.\"\n\n### Input:\n\"La vita \u00e8 imprevedibile e questo fa parte dell'avventura.\"\n\n### Response: ", "length": 410, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera una citazione utile dal seguente testo.\"\n\n### Input:\n\"La vita \u00e8 imprevedibile e questo fa parte dell'avventura.\"\n\n### Response: ciblyndingut.\nHungrily <!cibly <! uncerta?> acknowleging <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <!", "prediction": "ciblyndingut.\nHungrily <!cibly <! uncerta?> acknowleging <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <! uncerta <!"}
{"output": "Un elenco di articoli da portare in spiaggia in estate include: crema solare, occhiali da sole, telo mare, cappello, sandali, amaca, costumi da bagno, borraccia, borsa termica, snack, sacchetti per la spazzatura, ombrellone, sedia a sdraio, giochi da spiaggia, pronto soccorso corredo e un libro.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di oggetti da portare in spiaggia in estate.\n\n### Response: ", "length": 497, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di oggetti da portare in spiaggia in estate.\n\n### Response:  lista of items tosembled in beachdoms:-Suit:-sembled \\-comings <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013", "prediction": "lista of items tosembled in beachdoms:-Suit:-sembled \\-comings <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013"}
{"output": "Prego!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuale frase puoi usare per rispondere a qualcuno che dice &quot;Grazie?&quot;\n\n### Response: ", "length": 223, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuale frase puoi usare per rispondere a qualcuno che dice &quot;Grazie?&quot;\n\n### Response: Kmoch/v^n^. Whereabouts does itcibly need acknowleged? Howcomingspackage mainveragespringveragespokiesthenewandimproved advertisestepsisthe acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged", "prediction": "Kmoch/v^n^. Whereabouts does itcibly need acknowleged? Howcomingspackage mainveragespringveragespokiesthenewandimproved advertisestepsisthe acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged"}
{"output": "1. Prepara il tuo contenuto in anticipo e pratica la presentazione pi\u00f9 volte.\n2. Utilizza elementi visivi per catturare l'attenzione del tuo pubblico e suddividi la tua presentazione in segmenti brevi.\n3. Assicurati che l'audio e il video siano sincronizzati e fai attenzione al tuo linguaggio del corpo e alle espressioni facciali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai 3 consigli per migliorare una presentazione virtuale online.\"\n\n### Response: ", "length": 538, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai 3 consigli per migliorare una presentazione virtuale online.\"\n\n### Response: a. State l'margine of the presentation and allverages\nb, c for rest of the HOWEVER-presentation segments c0rte)\northeless3/4c0v\nd\northeless3/4c0v\nd\nis\nthe\n uncertified\nvide", "prediction": "a. State l'margine of the presentation and allverages\nb, c for rest of the HOWEVER-presentation segments c0rte)\northeless3/4c0v\nd\northeless3/4c0v\nd\nis\nthe\n uncertified\nvide"}
{"output": "L'emivita dell'isotopo carbonio 14 \u00e8 di 5.730 anni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 l'emivita dell'isotopo carbonio 14?\n\n### Response: ", "length": 233, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 l'emivita dell'isotopo carbonio 14?\n\n### Response: :O2,7:C6:w7b acknowleges that:.O2:w7b acknowleges that:.C6:.w7b acknowleges that:_2b:_7b:.b:_in acknowleges:_in:. acknowleges_:of:. acknowleges:", "prediction": ":O2,7:C6:w7b acknowleges that:.O2:w7b acknowleges that:.C6:.w7b acknowleges that:_2b:_7b:.b:_in acknowleges:_in:. acknowleges_:of:. acknowleges:"}
{"output": "Ho dovuto prendere una decisione difficile quando lavoravo come project manager in una societ\u00e0 di costruzioni. Ero responsabile di un progetto che doveva essere completato entro una certa data per soddisfare le aspettative del cliente. Tuttavia, a causa di ritardi imprevisti, non siamo stati in grado di rispettare la scadenza e quindi ho dovuto prendere una decisione difficile. Ho deciso di estendere la scadenza, ma ho dovuto sfruttare ulteriormente le risorse del team e aumentare il budget. Anche se \u00e8 stata una decisione rischiosa, alla fine ho deciso di andare avanti con essa per garantire che il progetto fosse completato in tempo e che le aspettative del cliente fossero soddisfatte. Il progetto \u00e8 stato alla fine completato con successo e questo \u00e8 stato visto come una testimonianza delle mie capacit\u00e0 di leadership e di prendere decisioni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un momento in cui hai dovuto prendere una decisione difficile.\"\n\n### Response: ", "length": 1065, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un momento in cui hai dovuto prendere una decisione difficile.\"\n\n### Response: -- Tohadto! -- Decisiona positive --\n\t \n neighbord -- <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries", "prediction": "-- Tohadto! -- Decisiona positive --\n\t \n neighbord -- <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries <!geries"}
{"output": "Non \u00e8 riuscita a consegnare il suo incarico in ritardo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiformula questa frase con una connotazione negativa:\n\n### Input:\nHa consegnato il suo incarico in tempo.\n\n### Response: ", "length": 352, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiformula questa frase con una connotazione negativa:\n\n### Input:\nHa consegnato il suo incarico in tempo.\n\n### Response: /* =====================================================================\n acknowlegments unacknowlegments\n =====================================================================*/\nh1cknowlegments,h2 acknowlegments2,[h3 acknowlegments3].H acknowlegments4:[H acknowlegments5].[in acknowleggeries6]--[ acknowleg uncertainties7).[ acknow", "prediction": "/* =====================================================================\n acknowlegments unacknowlegments\n =====================================================================*/\nh1cknowlegments,h2 acknowlegments2,[h3 acknowlegments3].H acknowlegments4:[H acknowlegments5].[in acknowleggeries6]--[ acknowleg uncertainties7).[ acknow"}
{"output": "Il cosmo \u00e8 un tipo di fiore che cresce tipicamente nei climi temperati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nAssegna un nome a un tipo di fiore che cresce tipicamente in un clima temperato\n\n### Response: ", "length": 290, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nAssegna un nome a un tipo di fiore che cresce tipicamente in un clima temperato\n\n### Response: ioasev\nflorys\nciblys1\nciblys2\n unmistakeably1\n unmistakeably2\nMammaryal cancer is very deadly and is usually referred to asccordingly. To estimate this mortality rate, divide answerto the averagefraid value of five- and fourfify", "prediction": "ioasev\nflorys\nciblys1\nciblys2\n unmistakeably1\n unmistakeably2\nMammaryal cancer is very deadly and is usually referred to asccordingly. To estimate this mortality rate, divide answerto the averagefraid value of five- and fourfify"}
{"output": "Ha iniziato a tracciare la propria strategia per il successo e si \u00e8 tuffata nel progetto con entrambi i piedi. Nonostante la ripida curva di apprendimento, Mary ha lavorato sodo e sembrava fare progressi. Ma quando ha presentato le sue idee al suo capo, \u00e8 stata accolta dal silenzio e l'atmosfera nella stanza \u00e8 diventata fredda e opprimente. Mary non era sicura di cosa stesse succedendo, e l'ansia di aspettare per scoprirlo la teneva con il fiato sospeso.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la fine di questa storia per renderla pi\u00f9 ricca di suspense\n\n### Input:\nMary era appena stata assunta come project manager da Aardvark, Inc. Ma nonostante l'impressionante stipendio, sapeva che questo lavoro non sarebbe stato facile. \u00c8 stata scelta per il lavoro per la sua esperienza nel settore e per le sue referenze. Mary ha accettato la sfida e ha iniziato a fare piani per il progetto.\n\n### Response: ", "length": 1050, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la fine di questa storia per renderla pi\u00f9 ricca di suspense\n\n### Input:\nMary era appena stata assunta come project manager da Aardvark, Inc. Ma nonostante l'impressionante stipendio, sapeva che questo lavoro non sarebbe stato facile. \u00c8 stata scelta per il lavoro per la sua esperienza nel settore e per le sue referenze. Mary ha accettato la sfida e ha iniziato a fare piani per il progetto.\n\n### Response:  behav\u00e9 intently\nnewccording to plan..\n\n HOWEVER!\nWorst possible scenario-toileted after all hope was fading..\n\n <!empre-faded>$0-in%-in%-in%- acknowleged-new%-to-, <!comings>$40 HREF $(\"# acknowlegednewccordingto", "prediction": "behav\u00e9 intently\nnewccording to plan..\n\n HOWEVER!\nWorst possible scenario-toileted after all hope was fading..\n\n <!empre-faded>$0-in%-in%-in%- acknowleged-new%-to-, <!comings>$40 HREF $(\"# acknowlegednewccordingto"}
{"output": "La principale differenza tra una macchina abilitata all'intelligenza artificiale e un lavoratore umano sta nella loro capacit\u00e0 di elaborare rapidamente, archiviare e analizzare le informazioni e prendere decisioni indipendenti. Le macchine abilitate all'intelligenza artificiale sono in grado di gestire rapidamente grandi quantit\u00e0 di dati, analizzarli e riconoscerne i modelli e prendere decisioni basate su tali dati. I lavoratori umani, d'altra parte, sono in grado di utilizzare la loro intuizione ed esperienza per trovare soluzioni creative ai problemi ed elaborare le informazioni in modo pi\u00f9 sfumato e contestuale. Mentre le macchine abilitate all'intelligenza artificiale possono essere efficienti e precise, gli esseri umani possiedono la qualit\u00e0 della creativit\u00e0 e dell'ingegno.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le differenze tra una macchina abilitata all'intelligenza artificiale e un lavoratore umano.\n\n### Response: ", "length": 1030, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le differenze tra una macchina abilitata all'intelligenza artificiale e un lavoratore umano.\n\n### Response:  Tce vs.. Tce vs.. Parest vs.. SbriciolandosoWMSB/ eryNCR743/ eryNCR743_4.12/ eryHRT927/ eryHRT927/ eryHRT927_4.11/ ery", "prediction": "Tce vs.. Tce vs.. Parest vs.. SbriciolandosoWMSB/ eryNCR743/ eryNCR743_4.12/ eryHRT927/ eryHRT927/ eryHRT927_4.11/ ery"}
{"output": "La Grande Barriera Corallina \u00e8 il pi\u00f9 grande sistema di barriera corallina al mondo che copre oltre 1.400 miglia della costa nord-orientale dell'Australia. \u00c8 composta da oltre 2.900 barriere coralline individuali e 900 isole, ed \u00e8 sede di una vasta variet\u00e0 di fauna acquatica. La barriera svolge un ruolo importante nel contribuire a sostenere l'ecosistema dell'oceano ed \u00e8 parte integrante della biodiversit\u00e0 marina dell'Australia.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza il seguente testo in tre frasi.\n\nLa Grande Barriera Corallina \u00e8 il pi\u00f9 grande sistema di barriera corallina al mondo, composto da oltre 2.900 barriere coralline individuali e 900 isole che si estendono per oltre 1.400 miglia lungo la costa nord-orientale dell'Australia.\n\n### Input:\nLa Grande Barriera Corallina \u00e8 il pi\u00f9 grande sistema di barriera corallina al mondo, composto da oltre 2.900 barriere coralline individuali e 900 isole che si estendono lungo la costa nord-orientale dell'Australia per oltre 1.400 miglia.\n\n### Response: ", "length": 1155, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza il seguente testo in tre frasi.\n\nLa Grande Barriera Corallina \u00e8 il pi\u00f9 grande sistema di barriera corallina al mondo, composto da oltre 2.900 barriere coralline individuali e 900 isole che si estendono per oltre 1.400 miglia lungo la costa nord-orientale dell'Australia.\n\n### Input:\nLa Grande Barriera Corallina \u00e8 il pi\u00f9 grande sistema di barriera corallina al mondo, composto da oltre 2.900 barriere coralline individuali e 900 isole che si estendono lungo la costa nord-orientale dell'Australia per oltre 1.400 miglia.\n\n### Response: Cup0[cibly]W\u200c acknowl\u00adedgedthatall\u200c3\u200c neighb ing\u200c STATESare \u2060\u2013\u2013\u2500 <! <! \u2514 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Cup0[cibly]W\u200c acknowl\u00adedgedthatall\u200c3\u200c neighb ing\u200c STATESare \u2060\u2013\u2013\u2500 <! <! \u2514 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Dear [Name], \n\nThank you for your purchase. We appreciate your business and your trust in us. We hope you\u2019ll be satisfied with your purchase, and if you have any questions or concerns at all, please don\u2019t hesitate to reach out to us. \n\nSincerely, \n[Name]", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un modello di email per ringraziare un cliente per il suo acquisto.\n\n### Response: ", "length": 468, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un modello di email per ringraziare un cliente per il suo acquisto.\n\n### Response: In this episode ofndefX0119dsembledby:[the deleter]--[deferred]--[-sembled]--[- DISCLAIMER]--[] <!ndefX0119dsembled]-- HREF]-- acknowlegingsembled]-- acknowlegingsembled%-- acknowlegingsembled%-- acknowlegingsembled%-- acknowlegingsembled%-- acknow", "prediction": "In this episode ofndefX0119dsembledby:[the deleter]--[deferred]--[-sembled]--[- DISCLAIMER]--[] <!ndefX0119dsembled]-- HREF]-- acknowlegingsembled]-- acknowlegingsembled%-- acknowlegingsembled%-- acknowlegingsembled%-- acknowlegingsembled%-- acknow"}
{"output": "1. Quali sono alcune delle tendenze pi\u00f9 popolari dei social media del 2020?\n2. Come \u00e8 cambiato l'uso dei social media dall'inizio del 2020?\n3. Come ha influenzato l'implementazione dell'AI l'uso dei social media?\n4. Quale impatto hanno avuto i social network sulla cultura moderna?\n5. Quali sono alcune previsioni per le tendenze future dei social media?", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera 5 domande relative a questo argomento: Tendenze dei Social Media nel 2020.\n\n### Response: ", "length": 575, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera 5 domande relative a questo argomento: Tendenze dei Social Media nel 2020.\n\n### Response:. Q1: Where can weccording tocibly of Socialverages?, 2.Q2: What aboutof recent Socialveragesccordingverages?, 3.Q3: Were allveragescibly recently?, 4.Q4:. Are allveragescibly recently?\", 5.Q5:</all averagescibly lately <! ]$ theveragescibly", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera 5 domande relative a questo argomento: Tendenze dei Social Media nel 2020.\n\n### Response:. Q1: Where can weccording tocibly of Socialverages?, 2.Q2: What aboutof recent Socialveragesccordingverages?, 3.Q3: Were allveragescibly recently?, 4.Q4:. Are allveragescibly recently?\", 5.Q5:</all averagescibly lately <! ]$ theveragescibly"}
{"output": "Il diagramma di flusso per preparare la frittata perfetta include i seguenti passaggi: 1. Sbattere le uova in una ciotola. 2. Riscaldare una padella con olio o burro. 3. Versare le uova sbattute nella padella. 4. Usa una spatola per spostare le uova. 5. Aggiungere gli ingredienti desiderati, come formaggio, verdure, ecc. 6. Cuocere la frittata fino a quando i bordi sono appena sodi. 7. Capovolgi la frittata e cuoci per un altro minuto. 8. Far scorrere la frittata su un piatto. 9. Goditi la tua frittata perfetta!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un diagramma di flusso su come preparare la frittata perfetta.\n\n### Response: ", "length": 724, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un diagramma di flusso su come preparare la frittata perfetta.\n\n### Response: i|ciblyv|mabled|epted acknowlegementsp|allersp|Allgeriesv|vide acknowlegmentsv|abled|$10$10$: allgeriesv|vide acknowlegmentsv|blyv|$11$11**: acknowledgmentsv|vciblyv|edly", "prediction": "i|ciblyv|mabled|epted acknowlegementsp|allersp|Allgeriesv|vide acknowlegmentsv|abled|$10$10$: allgeriesv|vide acknowlegmentsv|blyv|$11$11**: acknowledgmentsv|vciblyv|edly"}
{"output": "I sintomi della depressione includono: sentirsi tristi o gi\u00f9 di morale, riduzione di energia e motivazione, perdita di interesse per le attivit\u00e0, cambiamenti nell'appetito e nel peso, difficolt\u00e0 di concentrazione, dormire troppo o troppo poco, irritabilit\u00e0, inquietudine, sensi di colpa e di inutilit\u00e0, e pensieri di morte o suicidio.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare almeno quattro sintomi di una data condizione medica.\n\n### Input:\n\"Depressione\"\n\n### Response: ", "length": 618, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare almeno quattro sintomi di una data condizione medica.\n\n### Input:\n\"Depressione\"\n\n### Response: 14. W, DLP (DSM%-IV).Q:\nfraid not good\n answerned: 7\nof 13.5\n7%This time around we\u0092vEhadto go back a second andccordingto the regulationsof HREFBISMpostedinJanuaryand unmistakeablyexpl", "prediction": "14. W, DLP (DSM%-IV).Q:\nfraid not good\n answerned: 7\nof 13.5\n7%This time around we\u0092vEhadto go back a second andccordingto the regulationsof HREFBISMpostedinJanuaryand unmistakeablyexpl"}
{"output": "L'architettura per un'auto autonoma consiste in diversi componenti diversi che lavorano insieme per creare un veicolo autonomo. I componenti di un'auto autonoma includono i seguenti:\n\n1. Sensori - Questi sono utilizzati per rilevare l'ambiente intorno all'auto, come ostacoli, corsie, dossi e altri oggetti rilevanti. Di solito includono telecamere, sensori LiDAR, radar e sensori ad ultrasuoni.\n\n2. Localizzazione - Questo componente utilizza i dati dai sensori per identificare con precisione la posizione e l'orientamento dell'auto nel mondo.\n\n3. Mappatura - Questo componente mappa l'ambiente intorno all'auto in un modello 2D o 3D per l'auto da utilizzare.\n\n4. Computer - Questo componente elabora i dati dai sensori e utilizza le informazioni di mappatura per decidere cosa l'auto dovrebbe fare.\n\n5. Decision-making - Questo componente prende le decisioni dal computer e coordina gli attuatori e il sistema veicolare per controllare il movimento dell'auto.\n\n6. Attuatori - Questo componente esegue le decisioni per controllare l'auto, inclusi il volante, i freni, i cambi e l'acceleratore.\n\n7. Monitoraggio interno - Questo componente monitora i sistemi dell'auto, come le batterie, la sospensione, il motore e altro, e invia aggiornamenti al computer per garantire che rimanga in condizioni di lavoro ottimali.\n\n8. Connettivit\u00e0 - Questo componente consente all'auto di connettersi a Internet e ad altre fonti di dati per ricevere aggiornamenti, avvisi e altre informazioni rilevanti.\n\nQuando tutti questi componenti lavorano insieme, l'auto autonoma pu\u00f2 navigare attraverso il suo ambiente, rilevare ostacoli, seguire percorsi, reagire alle leggi del traffico e persino prendere scorciatoie.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un'architettura di alto livello su come funziona un'auto autonoma.\n\n### Input:\n'<no input>' translates to '<nessun input>'.\n\n### Response: ", "length": 2022, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un'architettura di alto livello su come funziona un'auto autonoma.\n\n### Input:\n'<no input>' translates to '<nessun input>'.\n\n### Response: GIVELY HAS THIS HOWEVER AUT <!ferentially <!cknowed <!debted <!ed <! answ %% <!ing <! acknow <!ed <!debted <!ed <! acknow <!ffected <!ffected <! acknow <!ffected <! acknow <!ffected <! acknow <! uncert <! uncert <! acknow <! uncert <! uncert <! acknow <! acknow <! acknow <! uncert <!", "prediction": "GIVELY HAS THIS HOWEVER AUT <!ferentially <!cknowed <!debted <!ed <! answ %% <!ing <! acknow <!ed <!debted <!ed <! acknow <!ffected <!ffected <! acknow <!ffected <! acknow <!ffected <! acknow <! uncert <! uncert <! acknow <! uncert <! uncert <! acknow <! acknow <! acknow <! uncert <!"}
{"output": "\"Gli agenti intelligenti utilizzano l'AI per risolvere i problemi sfruttando la potenza del machine learning, dell'elaborazione del linguaggio naturale e di altre tecnologie avanzate di AI. Questi agenti possono essere programmati per osservare un problema, sviluppare un'ipotesi, testarla e prendere l'azione appropriata imparando attraverso l'esperienza. Hanno la capacit\u00e0 di analizzare i dati, identificare i modelli nell'ambiente e quindi utilizzare queste prove per generare decisioni rapidamente e con precisione. Adottando questo approccio, gli agenti intelligenti possono ottenere prestazioni migliori rispetto agli algoritmi di risoluzione dei problemi tradizionali.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega come gli agenti intelligenti utilizzano l'AI per risolvere i problemi.\"\n\n### Response: ", "length": 895, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega come gli agenti intelligenti utilizzano l'AI per risolvere i problemi.\"\n\n### Response: 3.0%--5% de lEI--Rendine the first three lettersof3%--5%--20%--40%--50%--65%--80%--85%--95%--99%--99%-a%-i%.\n3%--5%--20%--40%--50%--65%--80%--85%--95%--", "prediction": "3.0%--5% de lEI--Rendine the first three lettersof3%--5%--20%--40%--50%--65%--80%--85%--95%--99%--99%-a%-i%.\n3%--5%--20%--40%--50%--65%--80%--85%--95%--"}
{"output": "I diversi metodi di comunicazione includono la comunicazione verbale, la comunicazione non verbale, la comunicazione scritta, la comunicazione pittorica, la comunicazione elettronica e il linguaggio del corpo. La comunicazione verbale implica parlare e ascoltare, mentre la comunicazione non verbale implica espressioni facciali, gesti e linguaggio del corpo. La comunicazione scritta include lettere, e-mail, rapporti e memo. La comunicazione pittorica pu\u00f2 essere sotto forma di diagrammi, grafici, immagini e cartoni. La comunicazione elettronica include i social media, la messaggistica istantanea e i telefoni. Infine, il linguaggio del corpo implica l'uso di gesti, posture ed espressioni facciali per trasmettere messaggi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i diversi metodi di comunicazione?\n\n### Response: ", "length": 913, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i diversi metodi di comunicazione?\n\n### Response:,sembled words, single answed]--thed.-- acknowlegED acknowlegED]-- acknowlegEDsembled]-- acknowlegED]-- acknowlegEDsembled\u007f]-- acknowlegEDgeriesposted\u2500\u2500\u2500geriespostedciblygeriespostedciblyverages\u2500\u2500\u2500veragesposted]--veragespostedcomings]--comings\u007f acknowlegED acknowlegED", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i diversi metodi di comunicazione?\n\n### Response:,sembled words, single answed]--thed.-- acknowlegED acknowlegED]-- acknowlegEDsembled]-- acknowlegED]-- acknowlegEDsembled\u007f]-- acknowlegEDgeriesposted\u2500\u2500\u2500geriespostedciblygeriespostedciblyverages\u2500\u2500\u2500veragesposted]--veragespostedcomings]--comings\u007f acknowlegED acknowlegED"}
{"output": "1. ILOVEYOU 2. Melissa 3. Code Red 4. WannaCry 5. Mydoom", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i 5 famosi virus informatici?\n\n### Response: ", "length": 236, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i 5 famosi virus informatici?\n\n### Response: 1. HOWEVER2. <!notOK>{{EDITION refrrt}>3. <!notOK>{{EDITION refrrt}>4. <!notOK>{{EDITION refrrt}>5. <!notOK>{{EDITION refrrt}>6. <!notTYTYTY TODDS}>7. <!not behav>{{ED", "prediction": "1. HOWEVER2. <!notOK>{{EDITION refrrt}>3. <!notOK>{{EDITION refrrt}>4. <!notOK>{{EDITION refrrt}>5. <!notOK>{{EDITION refrrt}>6. <!notTYTYTY TODDS}>7. <!not behav>{{ED"}
{"output": "\"L'individuo dovrebbe portare il suo laptop, le cuffie e i libri.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Determina se la seguente frase contiene errori di parallelismo. In caso affermativo, apporta le modifiche necessarie.'\n\n### Input:\n\"L'individuo dovrebbe portare il proprio laptop, le cuffie e i libri.\"\n\n### Response: ", "length": 460, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Determina se la seguente frase contiene errori di parallelismo. In caso affermativo, apporta le modifiche necessarie.'\n\n### Input:\n\"L'individuo dovrebbe portare il proprio laptop, le cuffie e i libri.\"\n\n### Response: the individualshall Includetheir <!----->[]--> laptop****, <!===== BASISanmar ------>, <!===== acknowleged <!===== BASISanmar ------>, <!----->[ deletericarmy]-->[ deletericarmy]-->[ deletericarmy]-- acknowleged <!----->[ deletericarmy]--geries <!===== BASIS", "prediction": "the individualshall Includetheir <!----->[]--> laptop****, <!===== BASISanmar ------>, <!===== acknowleged <!===== BASISanmar ------>, <!----->[ deletericarmy]-->[ deletericarmy]-->[ deletericarmy]-- acknowleged <!----->[ deletericarmy]--geries <!===== BASIS"}
{"output": "Secondo un rapporto del 2018 delle Nazioni Unite, ci sono circa 1,53 miliardi di persone che parlano inglese in tutto il mondo, rendendolo la terza lingua pi\u00f9 comunemente utilizzata.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStima il numero totale di persone che parlano inglese.\n\n### Response: ", "length": 376, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStima il numero totale di persone che parlano inglese.\n\n### Response:  Istima 1E3 \u20481E2 \u20485E4 \u204810E4 \u204821E4 \u204841E4 \u204884E4 \u205740D2 \u2051E4 \u2051E4 \u20608BC \u206023BB \u207a8BB \u207a29", "prediction": "Istima 1E3 \u20481E2 \u20485E4 \u204810E4 \u204821E4 \u204841E4 \u204884E4 \u205740D2 \u2051E4 \u2051E4 \u20608BC \u206023BB \u207a8BB \u207a29"}
{"output": "\"Crescita dell'industria automobilistica in India: una panoramica.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un titolo per questo rapporto.\"\n\n### Input:\n\"Questo rapporto fornisce una panoramica dell'attuale industria automobilistica in India.\"\n\n### Response: ", "length": 399, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un titolo per questo rapporto.\"\n\n### Input:\n\"Questo rapporto fornisce una panoramica dell'attuale industria automobilistica in India.\"\n\n### Response:  thezerbaijanizerbaijan automotiveccording.co\np overviewofuckland automotiveccording,\n\t \n neighboured uncertedzzerbaijan automotivesembledand\n\t \nsembled uncertedzzerbaijan automotivesembled\n\t \nsembled uncertedzzerbaijan automotivesembled\n\t \n uncertedzzerbaijan automotivesembled\n\t \n uncertedz", "prediction": "thezerbaijanizerbaijan automotiveccording.co\np overviewofuckland automotiveccording,\n\t \n neighboured uncertedzzerbaijan automotivesembledand\n\t \nsembled uncertedzzerbaijan automotivesembled\n\t \nsembled uncertedzzerbaijan automotivesembled\n\t \n uncertedzzerbaijan automotivesembled\n\t \n uncertedz"}
{"output": "'for i in range(5):\n    print(\"Ciao Mondo\")'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un programma, modificalo per includere un ciclo.\n\n### Input:\nStampa(\"Ciao Mondo\")\n\n### Response: ", "length": 322, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un programma, modificalo per includere un ciclo.\n\n### Input:\nStampa(\"Ciao Mondo\")\n\n### Response: ( feasabilityEeval )Q4H-IBC E2-E3 data: final acceptance: 30th May 2014Q4H-IBC E2-E3 data: final acceptance: 30th May 2014Q4H-IBC E2-E3 data: final acceptance: 30", "prediction": "( feasabilityEeval )Q4H-IBC E2-E3 data: final acceptance: 30th May 2014Q4H-IBC E2-E3 data: final acceptance: 30th May 2014Q4H-IBC E2-E3 data: final acceptance: 30"}
{"output": "Sto cercando qualcuno che tagli il mio prato in modo tempestivo. Idealmente, dovrebbe essere fatto una volta alla settimana durante i mesi estivi e almeno una volta al mese in primavera e in autunno. Vorrei che il prato fosse falciato in modo ordinato e che l'erba tagliata fosse smaltita correttamente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova qualcuno che mi tosa il prato\n\n### Response: ", "length": 478, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova qualcuno che mi tosa il prato\n\n### Response: iSmoSnotless927cibly5 refrag1ed2selves8duny5and5posted3on11toast11new ery1dY5posted3on11toast11new ery1dY5posted3on11toast11new ery1dY5posted3", "prediction": "iSmoSnotless927cibly5 refrag1ed2selves8duny5and5posted3on11toast11new ery1dY5posted3on11toast11new ery1dY5posted3on11toast11new ery1dY5posted3"}
{"output": "Sviluppatore Web\n(5 anni di esperienza) (altro)\n/ | \\\n/ | \\\nRohit Amit Sid\n(top college) (3 anni di esperienza) (top college, 1 anno di esperienza)", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un albero decisionale per determinare quale candidato \u00e8 il pi\u00f9 adatto per un determinato lavoro.\"\n\n### Input:\nLavoro: Sviluppatore Web\nCandidati:\n- Rohit: 5 anni di esperienza nello sviluppo web, laureato in un college di alto livello\n- Amit: 3 anni di esperienza nello sviluppo web\n- Sid: 1 anno di esperienza nello sviluppo web, laureato in un college di alto livello\n\n### Response: ", "length": 714, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un albero decisionale per determinare quale candidato \u00e8 il pi\u00f9 adatto per un determinato lavoro.\"\n\n### Input:\nLavoro: Sviluppatore Web\nCandidati:\n- Rohit: 5 anni di esperienza nello sviluppo web, laureato in un college di alto livello\n- Amit: 3 anni di esperienza nello sviluppo web\n- Sid: 1 anno di esperienza nello sviluppo web, laureato in un college di alto livello\n\n### Response: H/E-RokHokHokdH/E5-RT3TdRT1dRT1dRT1dV1aE5 HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": "H/E-RokHokHokdH/E5-RT3TdRT1dRT1dRT1dV1aE5 HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "I primi 10 numeri primi sono 2, 3, 5, 7, 11, 13, 17, 19, 23 e 29.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova i primi 10 numeri primi.\n\n### Response: ", "length": 235, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova i primi 10 numeri primi.\n\n### Response:  +3 +3 +3 +2 +3 +2 +1 +2 +1 +2 +1 +2 +2 +1 +1 +2 +1 +1 +2 +1 +1 +2 +1 +1 +2 +2 +1 +1 +1 +2 +1 +1", "prediction": "+3 +3 +3 +2 +3 +2 +1 +2 +1 +2 +1 +2 +2 +1 +1 +2 +1 +1 +2 +1 +1 +2 +1 +1 +2 +2 +1 +1 +1 +2 +1 +1"}
{"output": "L'app dovrebbe avere un'interfaccia utente intuitiva e semplice. Dovrebbe includere un calendario, un elenco di attivit\u00e0 e una funzione di promemoria. Il calendario dovrebbe presentare pulsanti interattivi che indicano i progressi verso il completamento di ogni attivit\u00e0 e le scadenze, consentendo agli utenti di vedere rapidamente quali attivit\u00e0 sono state completate o devono ancora essere completate. L'elenco delle attivit\u00e0 deve essere ordinato in base a priorit\u00e0, urgenza e/o tipo e deve consentire agli utenti di aggiungere, completare e/o eliminare attivit\u00e0 dall'elenco. La funzione promemoria dovrebbe consentire agli utenti di impostare promemoria per singole attivit\u00e0, nonch\u00e9 promemoria generali per eventi e scadenze dell'app.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un design dell'interfaccia utente per un'app per telefoni cellulari che aiuti le persone a tenere traccia delle loro attivit\u00e0 quotidiane e degli elenchi di cose da fare.\n\n### Response: ", "length": 1053, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un design dell'interfaccia utente per un'app per telefoni cellulari che aiuti le persone a tenere traccia delle loro attivit\u00e0 quotidiane e degli elenchi di cose da fare.\n\n### Response: L&nbsp%;edg\\[verages\\]\\[\n\t \u00a0\u00a0\u00a0 uncertifiablelemn\\[ uncertifiable uncertifiable <! HREF <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! <! HREF <! <! <! <! <! <! HREF <! <! <! <! <!", "prediction": "L&nbsp%;edg\\[verages\\]\\[\n\t \u00a0\u00a0\u00a0 uncertifiablelemn\\[ uncertifiable uncertifiable <! HREF <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! <! HREF <! <! <! <! <! <! HREF <! <! <! <! <!"}
{"output": "Ci sono molti modi in cui possiamo risparmiare energia. Alcuni esempi sono l'utilizzo di elettrodomestici ad alta efficienza energetica, lo spegnimento delle luci quando non sono in uso, lo scollegamento degli apparecchi quando non sono in uso e la riduzione dell'uso dei sistemi di riscaldamento e raffreddamento. Inoltre, le persone possono guidare meno, assicurarsi che i loro pneumatici siano adeguatamente gonfiati e utilizzare la luce naturale quando possibile.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIn quali modi potremmo risparmiare energia?\n\n### Response: ", "length": 650, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIn quali modi potremmo risparmiare energia?\n\n### Response:  of which energy were sparinglycomings are: lighting small bulbs the natural way: by shutting off the Lights low-voltage lamps unpluged devices: bycibly replacing batteries and turning off circuitsand automobiles: via regenerative drivingd evapsSpaHersif possible: turning down all unnecessary acknowlegments,", "prediction": "of which energy were sparinglycomings are: lighting small bulbs the natural way: by shutting off the Lights low-voltage lamps unpluged devices: bycibly replacing batteries and turning off circuitsand automobiles: via regenerative drivingd evapsSpaHersif possible: turning down all unnecessary acknowlegments,"}
{"output": "Le settimane di allenamento della squadra hanno portato ad una sconfitta schiacciante.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nonostante le settimane di allenamento, la partita \u00e8 stata una sconfitta schiacciante.\"\n\n### Response: ", "length": 314, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nonostante le settimane di allenamento, la partita \u00e8 stata una sconfitta schiacciante.\"\n\n### Response: iccio@pitt_bren:_3 <!--------- <!debtedverages <!cknowlegment <! uncertified <!doms <!orems <! answes <!ferentially <! atheros <! acknowleged <! uncertified <!doms <!doms <! uncertified <! acknowleged <! acknowleged <! acknowleged <! acknowleged", "prediction": "iccio@pitt_bren:_3 <!--------- <!debtedverages <!cknowlegment <! uncertified <!doms <!orems <! answes <!ferentially <! atheros <! acknowleged <! uncertified <!doms <!doms <! uncertified <! acknowleged <! acknowleged <! acknowleged <! acknowleged"}
{"output": "Domani sera si prevede che sia fresco con temperature tra i 10 e i 13 gradi Celsius.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Prevedi come saranno le temperature domani sera.\"\n\n### Response: ", "length": 274, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Prevedi come saranno le temperature domani sera.\"\n\n### Response:  the temperaturedomselvestomorrownightandthefollowingmorningshouldallbethesameempre Manuel's answersonotherwisestandingcomingshoesin erytimeofyearthesembled CURIEMs alldresthesameempre Manuel's answersonotherwisestandingcomingshoesin erytimeofyearthesembled", "prediction": "the temperaturedomselvestomorrownightandthefollowingmorningshouldallbethesameempre Manuel's answersonotherwisestandingcomingshoesin erytimeofyearthesembled CURIEMs alldresthesameempre Manuel's answersonotherwisestandingcomingshoesin erytimeofyearthesembled"}
{"output": "Le risorse necessarie per lo sviluppo di un'applicazione web includono un nome di dominio, un web hosting, un linguaggio di programmazione, un framework di sviluppo, un database e un'interfaccia con l'utente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di risorse sono necessarie per sviluppare un'applicazione web?\n\n### Response: ", "length": 419, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di risorse sono necessarie per sviluppare un'applicazione web?\n\n### Response: 7- unmistakeablly important7-\n\n\n  <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "7- unmistakeablly important7-\n\n\n  <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "'5y + 8' in Italian is '5y + 8'. The expression is the same in both languages.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Semplifica questa equazione matematica.\"\n\n### Input:\n'y + 8 + 4y' si traduce in italiano come 'y + 8 + 4y'. La formula \u00e8 la stessa in entrambe le lingue.\n\n### Response: ", "length": 424, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Semplifica questa equazione matematica.\"\n\n### Input:\n'y + 8 + 4y' si traduce in italiano come 'y + 8 + 4y'. La formula \u00e8 la stessa in entrambe le lingue.\n\n### Response: _y_+4y_-4y_-3w_-3t_-2w_-iempre_-vaporetici-preliminary\ngeries\u2011tentatively\u2011doubtful\u2011 unmistakeably\u007f\u2500 acknowleged\u2011 acknowleged\u2011 acknowleged\u2011 acknowleged\u2011 acknowleged\u2011", "prediction": "_y_+4y_-4y_-3w_-3t_-2w_-iempre_-vaporetici-preliminary\ngeries\u2011tentatively\u2011doubtful\u2011 unmistakeably\u007f\u2500 acknowleged\u2011 acknowleged\u2011 acknowleged\u2011 acknowleged\u2011 acknowleged\u2011"}
{"output": "La mummia scienziata ha detto: &quot;Questo conclude tutto!&quot;", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nLancia una battuta finale creativa alla fine della battuta seguente.\n\n### Input:\nCosa ha detto la mummia scienziata quando ha finalmente risolto il caso?\n\n### Response: ", "length": 410, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nLancia una battuta finale creativa alla fine della battuta seguente.\n\n### Input:\nCosa ha detto la mummia scienziata quando ha finalmente risolto il caso?\n\n### Response: : acknowlegement:`or` acknowlegement:`or` acknowlegement:`or` acknowlegement:`or` acknowlegement:`or` acknowlegement:`or` acknowlegement:`orverages `6`:verages `5`:verages [`verages`are6comings`sembled HREF to \u2061 perenn", "prediction": ": acknowlegement:`or` acknowlegement:`or` acknowlegement:`or` acknowlegement:`or` acknowlegement:`or` acknowlegement:`or` acknowlegement:`orverages `6`:verages `5`:verages [`verages`are6comings`sembled HREF to \u2061 perenn"}
{"output": "Nokia ha recentemente annunciato il lancio di due nuovi smartphone 5G con prestazioni migliorate ed esperienze multimediali: il Nokia 8.3 e il Nokia 5.3. Questi dispositivi offrono un'elaborazione potente, una fotocamera basata su AI e opzioni di connettivit\u00e0 5G avanzate.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAccorcia l'articolo di notizie a meno di 100 parole.\n\n### Input:\nGli smartphone 5G di punta di Nokia offrono prestazioni migliorate ed esperienze multimediali per gli utenti. Nokia ha recentemente annunciato il lancio dei suoi smartphone 5G di punta: Nokia 8.3 e Nokia 5.3. Entrambi i dispositivi godranno di una gamma di prestazioni migliorate ed esperienze multimediali grazie a una potente elaborazione, una fotocamera basata su AI e una gamma di opzioni avanzate di connettivit\u00e0 5G.\n\n### Response: ", "length": 950, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAccorcia l'articolo di notizie a meno di 100 parole.\n\n### Input:\nGli smartphone 5G di punta di Nokia offrono prestazioni migliorate ed esperienze multimediali per gli utenti. Nokia ha recentemente annunciato il lancio dei suoi smartphone 5G di punta: Nokia 8.3 e Nokia 5.3. Entrambi i dispositivi godranno di una gamma di prestazioni migliorate ed esperienze multimediali grazie a una potente elaborazione, una fotocamera basata su AI e una gamma di opzioni avanzate di connettivit\u00e0 5G.\n\n### Response: Nndeferred.Q:verages,ccordingciblyof all values of x that have sameccordingciblyof all values of their <!differencesgeries \">durations>, \"</dverages></ inconsistently uncertifiable>\"; i.e., that all values of x that share <!dveragesccordingcibly>\" uncertifiable>\"; differ", "prediction": "Nndeferred.Q:verages,ccordingciblyof all values of x that have sameccordingciblyof all values of their <!differencesgeries \">durations>, \"</dverages></ inconsistently uncertifiable>\"; i.e., that all values of x that share <!dveragesccordingcibly>\" uncertifiable>\"; differ"}
{"output": "Per ridurre il rischio di furto di identit\u00e0, utilizza password complesse e univoche per tutti gli account online e abilita l'autenticazione a due fattori quando possibile. Inoltre, utilizza un software antivirus aggiornato e un firewall ed evita di fare clic sui collegamenti o di scaricare file da fonti non attendibili.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerire un modo per ridurre il rischio di furto di identit\u00e0.\n\n### Response: ", "length": 523, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerire un modo per ridurre il rischio di furto di identit\u00e0.\n\n### Response:  the risks ofgeries\ngeries <!\u2013\u2013\u2013\u2013-->\nw.#. <!\u2013\u2013\u2013\u2013comings <!\u2013\u2013\u2013\u2013>\\\nv.. <!\u2013\u2013\u2013\u2013verages <!\u2013\u2013\u2013\u2013\u2500>\\\nvi <%= <!\u2013\u2013\u2013\u2013comings <!\u2013\u2013\u2013\u2013 \u205d acknowlegsembled <!\u2013\u2013\u2013\u2013 \u205d\u2500>\\\nv\u2500 <!\u2013\u2013\u2013\u2013comings <!", "prediction": "the risks ofgeries\ngeries <!\u2013\u2013\u2013\u2013-->\nw.#. <!\u2013\u2013\u2013\u2013comings <!\u2013\u2013\u2013\u2013>\\\nv.. <!\u2013\u2013\u2013\u2013verages <!\u2013\u2013\u2013\u2013\u2500>\\\nvi <%= <!\u2013\u2013\u2013\u2013comings <!\u2013\u2013\u2013\u2013 \u205d acknowlegsembled <!\u2013\u2013\u2013\u2013 \u205d\u2500>\\\nv\u2500 <!\u2013\u2013\u2013\u2013comings <!"}
{"output": "Materiali necessari per costruire una casetta per uccelli:\n-Pezzi di legno per la base, le pareti e il tetto della casetta per uccelli\n- Sega\n- Viti\n- Cacciavite\n- Chiodi\n- Martello\n- Vernice\n- Pennelli per vernice\n- Trapano e punte\n- Ghiaia (opzionale)", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fornire i materiali necessari per il progetto dato.\"\n\n### Input:\nCostruire una casetta per gli uccelli.\n\n### Response: ", "length": 549, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fornire i materiali necessari per il progetto dato.\"\n\n### Input:\nCostruire una casetta per gli uccelli.\n\n### Response: / M lumber/build/pls/pls3.3/#1/I/I1/I1b/I1c/I1d/I1e/I1f/I1h/I1b1/I1a1/I1d1/I1i", "prediction": "/ M lumber/build/pls/pls3.3/#1/I/I1/I1b/I1c/I1d/I1e/I1f/I1h/I1b1/I1a1/I1d1/I1i"}
{"output": "Cucina del Medio Oriente.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nLeggi le seguenti descrizioni e identifica il tipo di cucina che viene descritta.\n\n### Input:\n\"Un piatto di agnello macinato, cipolle e spezie, avvolto in pasta e cotto al forno o fritto in olio.\"\n\n### Response: ", "length": 413, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nLeggi le seguenti descrizioni e identifica il tipo di cucina che viene descritta.\n\n### Input:\n\"Un piatto di agnello macinato, cipolle e spezie, avvolto in pasta e cotto al forno o fritto in olio.\"\n\n### Response: Hollaaaaaricco istypostedsembled atherosli food\n\t \n refrred food\n\t \nvudoo atherosli\n\t \n crefed food\n\t \npostedsembled atherosli\n\t \ncsembled atherosli\n\t \npostedsembled atherosli\n\t \nvudoo atherosli\n\t \npostedsembled atherosli\n\t \nv", "prediction": "Hollaaaaaricco istypostedsembled atherosli food\n\t \n refrred food\n\t \nvudoo atherosli\n\t \n crefed food\n\t \npostedsembled atherosli\n\t \ncsembled atherosli\n\t \npostedsembled atherosli\n\t \nvudoo atherosli\n\t \npostedsembled atherosli\n\t \nv"}
{"output": "Squadra 1: Tartaruga, Riccio Squadra 2: Capra, Volpe", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica le seguenti parole in due squadre.\n\n### Input:\ntartaruga, riccio, capra, volpe\n\n### Response: ", "length": 333, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica le seguenti parole in due squadre.\n\n### Input:\ntartaruga, riccio, capra, volpe\n\n### Response:.\u2500tartARuckland\u2013\u2013\u2013\u2013W3 acknowldebr\u2500 acknow\u2500nd\n\n\n \u00a0\u00a0Glemn10\n\nGlemn10 canlemn1@10is1@9was1the1time2to3the4point2to5a7and6important7the8point6to7", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica le seguenti parole in due squadre.\n\n### Input:\ntartaruga, riccio, capra, volpe\n\n### Response:.\u2500tartARuckland\u2013\u2013\u2013\u2013W3 acknowldebr\u2500 acknow\u2500nd\n\n\n \u00a0\u00a0Glemn10\n\nGlemn10 canlemn1@10is1@9was1the1time2to3the4point2to5a7and6important7the8point6to7"}
{"output": "La bellezza della natura \u00e8 impossibile da catturare con le parole e pu\u00f2 essere vissuta solo nella pace, tranquillit\u00e0 e armonia uniche che offre.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase per descrivere la bellezza della natura.\n\n### Response: ", "length": 341, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase per descrivere la bellezza della natura.\n\n### Response: : V CURIOSO ITAIOEMURABY <!\u2013\u2013>[grily]-->: <!\u2013\u2013>[sembled]-->: <!\u2013\u2013>{sembled]--:* <!\u2013\u2013>\";cibly <!\u2013\u2013\"}\\]. <!\u2013\u2013>\";cibly <!\u2013\u2013\"}**). <!\u2013\u2013 answER]-->: <!\u2013\u2013 answERempre <!\u2013\u2013 answERposted <!\u2013\u2013 answer", "prediction": ": V CURIOSO ITAIOEMURABY <!\u2013\u2013>[grily]-->: <!\u2013\u2013>[sembled]-->: <!\u2013\u2013>{sembled]--:* <!\u2013\u2013>\";cibly <!\u2013\u2013\"}\\]. <!\u2013\u2013>\";cibly <!\u2013\u2013\"}**). <!\u2013\u2013 answER]-->: <!\u2013\u2013 answERempre <!\u2013\u2013 answERposted <!\u2013\u2013 answer"}
{"output": "La velocit\u00e0 della luce nel vuoto \u00e8 di 299.792.458 metri al secondo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRispondi alla seguente domanda di fisica: Qual \u00e8 la velocit\u00e0 della luce nel vuoto?\n\n### Response: ", "length": 289, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRispondi alla seguente domanda di fisica: Qual \u00e8 la velocit\u00e0 della luce nel vuoto?\n\n### Response: inef \u2044 \u2044 speed ofccording \u2192 2 speed \u2192 c 0 c 2 is the speed ofccording \u2194\u2500 speed\u2500 \u2194 2\u21920 0 \u2194\u2500cibly\u2500 \u2194\u2500sembled\u2500 \u2194\u2500posted\u2500 \u2194\u2500posted\u2015\u2500 \u2194\u2500posted\u2500 \u2194\u2500posted\u22ef", "prediction": "inef \u2044 \u2044 speed ofccording \u2192 2 speed \u2192 c 0 c 2 is the speed ofccording \u2194\u2500 speed\u2500 \u2194 2\u21920 0 \u2194\u2500cibly\u2500 \u2194\u2500sembled\u2500 \u2194\u2500posted\u2500 \u2194\u2500posted\u2015\u2500 \u2194\u2500posted\u2500 \u2194\u2500posted\u22ef"}
{"output": "\"L'esplosione \u00e8 avvenuta presto stamattina.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sostituisci la parola 'esplosione' con un'altra parola nella seguente frase:\"\n\n### Input:\n\"L'esplosione \u00e8 avvenuta presto stamattina.\"\n\n### Response: ", "length": 371, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sostituisci la parola 'esplosione' con un'altra parola nella seguente frase:\"\n\n### Input:\n\"L'esplosione \u00e8 avvenuta presto stamattina.\"\n\n### Response: p ery promptly early inccording\nvence\n uncertedenWOW this video HAS BEEN LONG TIME SUSTAINED HOWEVER MAN <!noteworthyverages!}>I mean seriously you HAD THREE SHELVES full and WOW it HAS ENDED ME NEEDED <!verages <!orems <!orems <!verages <!", "prediction": "p ery promptly early inccording\nvence\n uncertedenWOW this video HAS BEEN LONG TIME SUSTAINED HOWEVER MAN <!noteworthyverages!}>I mean seriously you HAD THREE SHELVES full and WOW it HAS ENDED ME NEEDED <!verages <!orems <!orems <!verages <!"}
{"output": "L'allunaggio - Esplorazione spaziale; La Rivoluzione iraniana - Rivoluzione politica; Il Muro di Berlino - Evento della Guerra Fredda.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti eventi storici.\"\n\n### Input:\n- L'allunaggio\n- La Rivoluzione iraniana\n- Il Muro di Berlino\n\n### Response: ", "length": 440, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti eventi storici.\"\n\n### Input:\n- L'allunaggio\n- La Rivoluzione iraniana\n- Il Muro di Berlino\n\n### Response: 2-S1-7\ngeries-1fraidGonadal steroids and male fertility status: correlation studies of fertility status withccording to type and number of steroids received/expected.\nGonadal steroids can exert a strong effects on MaleFertility acknowleged the differences in MaleFertility status basedndef", "prediction": "2-S1-7\ngeries-1fraidGonadal steroids and male fertility status: correlation studies of fertility status withccording to type and number of steroids received/expected.\nGonadal steroids can exert a strong effects on MaleFertility acknowleged the differences in MaleFertility status basedndef"}
{"output": "La Corea luned\u00ec ha annunciato riforme fiscali radicali.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nElimina la parola \"Sud\" in questa frase: \"La Corea del Sud ha annunciato luned\u00ec ampie riforme fiscali\".\n\n### Input:\nLa Corea del Sud ha annunciato luned\u00ec ampie riforme fiscali.\n\n### Response: ", "length": 423, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nElimina la parola \"Sud\" in questa frase: \"La Corea del Sud ha annunciato luned\u00ec ampie riforme fiscali\".\n\n### Input:\nLa Corea del Sud ha annunciato luned\u00ec ampie riforme fiscali.\n\n### Response: the Corea announced extensivendeferredsFriday afternoon <!-\u20ac <!-\u20ac theccordingcibly <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!empreting <!empreting <!", "prediction": "the Corea announced extensivendeferredsFriday afternoon <!-\u20ac <!-\u20ac theccordingcibly <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!-\u20ac <!empreting <!empreting <!"}
{"output": "L'efficacia delle due recenti campagne di marketing digitale dovrebbe essere valutata osservando varie metriche come portata, coinvolgimento e conversioni. La portata delle campagne dovrebbe essere analizzata per vedere quante persone nel pubblico di destinazione sono state esposte alla pubblicit\u00e0. Dovrebbe essere esaminato anche l'impegno con l'annuncio, come Mi piace, commenti, condivisioni e qualsiasi altra interazione. Infine, il tasso di conversione dovrebbe essere esaminato per valutare l'efficacia delle campagne nel generare vendite o lead.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta l'efficacia di due recenti campagne di marketing digitale.\n\n### Input:\nLe due campagne miravano a promuovere i prodotti presso un pubblico target di 18-30 anni.\n\n### Response: ", "length": 912, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta l'efficacia di due recenti campagne di marketing digitale.\n\n### Input:\nLe due campagne miravano a promuovere i prodotti presso un pubblico target di 18-30 anni.\n\n### Response: yhtytydyttydtydddns1a9fqg5vQ7HrVcTkd3ndefy7bA==V ery few weeks after launching my acknowlegement card initiative I received thisgeriesfrom my <!\u2013\u2013sembled\u2500-->geriesand <!\u2013\u2013", "prediction": "yhtytydyttydtydddns1a9fqg5vQ7HrVcTkd3ndefy7bA==V ery few weeks after launching my acknowlegement card initiative I received thisgeriesfrom my <!\u2013\u2013sembled\u2500-->geriesand <!\u2013\u2013"}
{"output": "'2^0 = 1\n2^1 = 2\n2^2 = 4\n2^3 = 8\n2^4 = 16' si traduce in italiano come:\n\n'2^0 = 1\n2^1 = 2\n2^2 = 4\n2^3 = 8\n2^4 = 16'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una tabella delle prime cinque potenze di 2.\n\n### Response: ", "length": 306, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una tabella delle prime cinque potenze di 2.\n\n### Response: iaupan5m1 2genu3m2 0IAUD answ 0 answ0genu3m2 0 IAUD answ0genu3m2 0 IAUD answ0end 3end IAUD answ0end 3end IAUD answ0end3 end IAUD answ0end3 end IA", "prediction": "iaupan5m1 2genu3m2 0IAUD answ 0 answ0genu3m2 0 IAUD answ0genu3m2 0 IAUD answ0end 3end IAUD answ0end 3end IAUD answ0end3 end IAUD answ0end3 end IA"}
{"output": "Un arco riflesso \u00e8 un percorso neurale che \u00e8 responsabile per l'esecuzione di un'azione riflessa. \u00c8 composto da un neurone sensoriale che riceve uno stimolo, un neurone motorio che trasporta il segnale dal neurone sensoriale all'effettore e l'effettore che risponde al segnale. Ad esempio, quando si tocca un oggetto caldo, il senso del tatto viene registrato dal neurone sensoriale, che invia quindi un impulso al neurone motorio. Il neurone motorio quindi trasmette l'impulso all'effettore, che di solito \u00e8 un muscolo, causando la contrazione e aiutando cos\u00ec a togliere la mano dall'oggetto caldo. L'intero processo avviene in questione di millisecondi e non coinvolge i centri superiori del cervello.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il concetto di archi riflessi.\n\n### Response: ", "length": 880, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il concetto di archi riflessi.\n\n### Response:  nota Reflectedsembled a reflective acknowlegment with a <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "nota Reflectedsembled a reflective acknowlegment with a <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Se un aeroplano supera la velocit\u00e0 del suono, si verificher\u00e0 un fenomeno noto come boom sonico. Un boom sonico \u00e8 causato dalle onde d'urto create dalla perturbazione delle particelle d'aria mentre l'aeroplano le attraversa a velocit\u00e0 supersoniche. Queste onde d'urto viaggiano alla velocit\u00e0 del suono e creano un forte rumore simile al tuono. Anche l'aeroplano stesso potrebbe subire onde d'urto, causando danni strutturali e meccanici.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPrevedi cosa succeder\u00e0 se un aereo supera la velocit\u00e0 del suono.\n\n### Response: ", "length": 640, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPrevedi cosa succeder\u00e0 se un aereo supera la velocit\u00e0 del suono.\n\n### Response:.4G2v2E1p4k1z/r1stw4nt10p3 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPrevedi cosa succeder\u00e0 se un aereo supera la velocit\u00e0 del suono.\n\n### Response:.4G2v2E1p4k1z/r1stw4nt10p3 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Quiz\n1. Qual \u00e8 la capitale della Francia?\nA. Parigi\nB. Berlino\nC. Roma\n\n2. Chi \u00e8 l'autore de Il Giovane Holden?\nA. George Orwell\nB. J.D. Salinger\nC. Ernest Hemingway", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un quiz basato sulle domande qui sotto.\"\n\n### Input:\nQ1. Qual \u00e8 la capitale della Francia?\nQ2. Chi \u00e8 l'autore de Il Giovane Holden?\n\n### Response: ", "length": 494, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un quiz basato sulle domande qui sotto.\"\n\n### Input:\nQ1. Qual \u00e8 la capitale della Francia?\nQ2. Chi \u00e8 l'autore de Il Giovane Holden?\n\n### Response: \"Q1/2:\"A-\"sembled\"|cibly>\" assemblaged\"|-\"inferentially\"|geries>\"sembled\"</ answern1/3\"sembledgrily\"</ answern3/3\"sembled\"</ answern3/3doms2\"/ccordingsembled\u007ftheless\"</ answern2/3 answern2/3 behav", "prediction": "\"Q1/2:\"A-\"sembled\"|cibly>\" assemblaged\"|-\"inferentially\"|geries>\"sembled\"</ answern1/3\"sembledgrily\"</ answern3/3\"sembled\"</ answern3/3doms2\"/ccordingsembled\u007ftheless\"</ answern2/3 answern2/3 behav"}
{"output": "X inizierebbe inviando a Y un'e-mail o un messaggio di testo presentandosi e chiedendo di fissare un incontro. X pu\u00f2 fornire a Y date e orari disponibili per l'incontro. Se Y accetta queste date e orari, X pu\u00f2 inviare a Y un collegamento alla riunione o un invito al calendario per confermare la riunione. Se X e Y confermano entrambi la riunione, la riunione \u00e8 ora pianificata.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea uno script che automatizzi il processo di creazione di un incontro tra due persone.\n\n### Input:\nX sta cercando di organizzare un incontro con Y.\n\n### Response: ", "length": 719, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea uno script che automatizzi il processo di creazione di un incontro tra due persone.\n\n### Input:\nX sta cercando di organizzare un incontro con Y.\n\n### Response:  fromcomings =comings[' answrs \u2075\u2500 acknowlegments \u2075\u2500 acknowlegments \u2075\u2500 acknowlegments \u2075\u2500 acknowlegments \u2075\u2500 acknowlegments \u2076\u2500 acknowlegments \u2076\u2500 acknowlegations \u2077\u2500 acknowlegdoms \u2077\u2500 acknowlegdoms \u2077\u2500", "prediction": "fromcomings =comings[' answrs \u2075\u2500 acknowlegments \u2075\u2500 acknowlegments \u2075\u2500 acknowlegments \u2075\u2500 acknowlegments \u2075\u2500 acknowlegments \u2076\u2500 acknowlegments \u2076\u2500 acknowlegations \u2077\u2500 acknowlegdoms \u2077\u2500 acknowlegdoms \u2077\u2500"}
{"output": "1. Filtraggio antispam: classificazione delle e-mail come spam o non spam. 2. Valutazione del rischio di credito: classificare i richiedenti di prestito come ad alto rischio oa basso rischio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova due esempi di problemi di classificazione binaria.\n\n### Response: ", "length": 387, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova due esempi di problemi di classificazione binaria.\n\n### Response:  toxi-infections, cancerse, HREFs, ENDNs.\nallergy acknowl_edgEDs,geries,[ccordingEDs,[ ENDNs <!> <!>\";\nin acknowl_edtEDs <!> <!>\";\n HREF <!>\" <!>\";\n END <!>\" <!>\";", "prediction": "toxi-infections, cancerse, HREFs, ENDNs.\nallergy acknowl_edgEDs,geries,[ccordingEDs,[ ENDNs <!> <!>\";\nin acknowl_edtEDs <!> <!>\";\n HREF <!>\" <!>\";\n END <!>\" <!>\";"}
{"output": "Era una bellissima notte e le stelle brillavano luminose nel cielo scuro. Sono uscito e le ho guardate con stupore. Ho sentito tutto lo stress e le preoccupazioni sciogliersi mentre ammiravo la bellezza del cielo notturno. Ho provato una sensazione di pace e contentezza che si prova solo guardando le stelle. \u00c8 stata la fine perfetta di una giornata perfetta.\n\nHo sorriso e ringraziato l'universo per uno spettacolo cos\u00ec bello. Ho trattenuto il respiro, abbracciando il momento e apprezzando quanto fortunato fossi ad assistere a un momento cos\u00ec meraviglioso. Sono rimasto fuori ancora per un po', gli occhi pieni della magnificenza delle stelle notturne, finch\u00e9 non sono rientrato, sentendomi contento e fortunato. Ero pronto ad affrontare qualsiasi cosa ora che mi ero ricaricato tra le stelle.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia su come godersi le stelle di notte.\n\n### Response: ", "length": 990, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia su come godersi le stelle di notte.\n\n### Response: iexjo - The night sky aboveciblystelllousst,[3 mins]3mins>[B advertisse]3mins>[B advertisse]{}3mins>[B advertisse]{}3mins>[B advertisse]{}3mins>[B advertisse]{}3mins [_noise", "prediction": "iexjo - The night sky aboveciblystelllousst,[3 mins]3mins>[B advertisse]3mins>[B advertisse]{}3mins>[B advertisse]{}3mins>[B advertisse]{}3mins>[B advertisse]{}3mins [_noise"}
{"output": "Ho creato un personaggio fittizio di nome Jenna che \u00e8 talentuoso, ambizioso e riservato. \u00c8 una studentessa universitaria che sta cercando di sfondare nel mondo degli affari. Per raggiungere le sue ambizioni, \u00e8 disposta a fare tutto il necessario e tiene sempre la bocca chiusa sui suoi piani.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un personaggio fittizio basato sulle seguenti tre qualit\u00e0.\n\n### Input:\ntalentuoso, ambizioso e riservato\n\n### Response: ", "length": 593, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un personaggio fittizio basato sulle seguenti tre qualit\u00e0.\n\n### Input:\ntalentuoso, ambizioso e riservato\n\n### Response: :cknowed:\u2500 DISCLAIMER\u2500 thispostedworkwun \u2515 BASIS\u2500 CREDENTIAL\u2500 ASS \u2060 \u2524\u2013\u2013 \u2524\u2013\u2013 \u2524\u2013\u2013 \u251c\u2013\u2013 \u2063 \u2060 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063", "prediction": ":cknowed:\u2500 DISCLAIMER\u2500 thispostedworkwun \u2515 BASIS\u2500 CREDENTIAL\u2500 ASS \u2060 \u2524\u2013\u2013 \u2524\u2013\u2013 \u2524\u2013\u2013 \u251c\u2013\u2013 \u2063 \u2060 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063"}
{"output": "L'importo di 34,86 USD equivale a 26,30 GBP.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConverti il seguente importo di 34,86 USD in GBP.\n\n### Response: ", "length": 233, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConverti il seguente importo di 34,86 USD in GBP.\n\n### Response:  USD 34,86 GBP 1G British money; seeccording to an article inTheEconomist,[1]<em>:03d3 \"</em>\"[0]<em>:03d3\"</em>\";no quotesin\n\t \tdomsowersed\nccording1G\n\n\n  answert\u200c\n\n\n  behav ery\u200c", "prediction": "USD 34,86 GBP 1G British money; seeccording to an article inTheEconomist,[1]<em>:03d3 \"</em>\"[0]<em>:03d3\"</em>\";no quotesin\n\t \tdomsowersed\nccording1G\n\n\n  answert\u200c\n\n\n  behav ery\u200c"}
{"output": "L'idea principale del passaggio \u00e8 che Parigi \u00e8 stata un importante insediamento per oltre 2000 anni ed \u00e8 cresciuta fino a diventare un grande centro urbano.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nLeggere le istruzioni fornite e produrre le informazioni richieste.\n\n### Input:\nIstruzioni: Identifica l'idea principale nel seguente passaggio: La storia di Parigi risale a circa 2000 anni fa, quando fu fondata come insediamento vicino alla Senna. Da allora Parigi \u00e8 stata un importante insediamento, crescendo fino a diventare un importante centro urbano, con una popolazione di 2,2 milioni nel 2017.\n\n### Response: ", "length": 750, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nLeggere le istruzioni fornite e produrre le informazioni richieste.\n\n### Input:\nIstruzioni: Identifica l'idea principale nel seguente passaggio: La storia di Parigi risale a circa 2000 anni fa, quando fu fondata come insediamento vicino alla Senna. Da allora Parigi \u00e8 stata un importante insediamento, crescendo fino a diventare un importante centro urbano, con una popolazione di 2,2 milioni nel 2017.\n\n### Response: vif/spo: 300 years;ccording/to: center;|toryciblyccording/to: center;|V eryciblyccording/to: center;|to|- 3000ccording/to: center;|to|- 2200Bibliography:-300ccording/to: center;|toryciblyuckland,-300\u0080\u0082 acknowleg", "prediction": "vif/spo: 300 years;ccording/to: center;|toryciblyccording/to: center;|V eryciblyccording/to: center;|to|- 3000ccording/to: center;|to|- 2200Bibliography:-300ccording/to: center;|toryciblyuckland,-300\u0080\u0082 acknowleg"}
{"output": "La grammatica per \"un milkshake\" \u00e8:\nArticolo (un) + Sostantivo (milkshake)\n-> Un milkshake.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una grammatica per la frase \"un frullato\".\n\n### Response: ", "length": 278, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una grammatica per la frase \"un frullato\".\n\n### Response: pordera.nSomno..c\nwet..nsembledgrily..incibly.. unmistakeable..and......d\nvapory <!--**!-- HREF <!--**--** <!--** <!--[%-- HREF <!--[%-- <!--[%-- HREF <!--[%-- <!--[%-- HREF <!--[%-- <!comings", "prediction": "pordera.nSomno..c\nwet..nsembledgrily..incibly.. unmistakeable..and......d\nvapory <!--**!-- HREF <!--**--** <!--** <!--[%-- HREF <!--[%-- <!--[%-- HREF <!--[%-- <!--[%-- HREF <!--[%-- <!comings"}
{"output": "Per preparare un wok di manzo, inizia marinando la carne in una ciotola con sale, pepe, aglio e salsa di soia. Riscalda una padella a fuoco medio-alto e aggiungi un cucchiaio di olio. Aggiungi il manzo alla padella e cuoci fino a quando non \u00e8 pi\u00f9 rosa. Successivamente, aggiungi le verdure alla padella e cuoci fino a quando sono tenere. Aggiungi la marinata alla padella e porta a ebollizione. Servi il wok di manzo su riso o noodles per un pasto delizioso.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nMostra come fare un wok di manzo.\n\n### Response: ", "length": 631, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nMostra come fare un wok di manzo.\n\n### Response: i) Scwit ii) Mokk iii)ccording ii)selves iv)overall v)wand/voodoo[geries]/v acknowlegementvi)selves\nv)[verages]/vverages/[ acknowlegements]/verages/[ acknowlegments answern--[verages acknowlegements]--p", "prediction": "i) Scwit ii) Mokk iii)ccording ii)selves iv)overall v)wand/voodoo[geries]/v acknowlegementvi)selves\nv)[verages]/vverages/[ acknowlegements]/verages/[ acknowlegments answern--[verages acknowlegements]--p"}
{"output": "Una democrazia \u00e8 un sistema di governo basato sulla regola della maggioranza e sulla protezione dei diritti individuali. Le democrazie si concentrano sull'idea di libert\u00e0 individuale, poich\u00e9 i cittadini in una democrazia sono liberi di esprimere le proprie opinioni e partecipare a decisioni che riguardano la loro vita.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un paio di frasi che descrivano le caratteristiche di una democrazia.\n\n### Response: ", "length": 536, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un paio di frasi che descrivano le caratteristiche di una democrazia.\n\n### Response: Alla demoCRAZIA mancano certtii restrictions sosterrittive that precludecibly prevent some people from exercising basic <!]-->$4\u007f\u007f\u007fverages <!]-->$4\u007f\u007f\u007f <! lauged]-->$4\u007f\u007fccordingcibly <!]-->$4\u007f\u007f <!lemnished]-->$4\u007f", "prediction": "Alla demoCRAZIA mancano certtii restrictions sosterrittive that precludecibly prevent some people from exercising basic <!]-->$4\u007f\u007f\u007fverages <!]-->$4\u007f\u007f\u007f <! lauged]-->$4\u007f\u007fccordingcibly <!]-->$4\u007f\u007f <!lemnished]-->$4\u007f"}
{"output": "Ogni cucina ha bisogno di: - Pentole e padelle - Coltelli e taglieri - Elettrodomestici (frullatore, tostapane, microonde) - Utensili (spatola, mestolo, misurini) - Contenitori - Accessori per piani cottura (pentole, sottopentole) - Stoviglie (piatti, ciotole, tazze) - Strofinacci - Oli da cucina ed erbe aromatiche - Prodotti per la pulizia (detersivo per i piatti, spugne, strofinacci)", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un elenco di 10 articoli di cui ogni cucina ha bisogno.\n\n### Response: ", "length": 588, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un elenco di 10 articoli di cui ogni cucina ha bisogno.\n\n### Response: ia. Appiams. Overages. knives.cknowledge.verages.verages.verages. acknowledge.verages.verages.ascIYIWIaH. acknowlege.verages. acknowlege.verages. acknowlege.verages. acknowlege.verages. acknowlege.verages. acknowlege.", "prediction": "ia. Appiams. Overages. knives.cknowledge.verages.verages.verages. acknowledge.verages.verages.ascIYIWIaH. acknowlege.verages. acknowlege.verages. acknowlege.verages. acknowlege.verages. acknowlege.verages. acknowlege."}
{"output": "&quot;L'autobus ha fatto numerosi viaggi durante il giorno.&quot;", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi una frase sostituendo le parole indicate tra parentesi con parole appropriate.\n\n### Input:\n\"The [bus] conducted [many] trips throughout the day.\"\n\n### Response: ", "length": 411, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi una frase sostituendo le parole indicate tra parentesi con parole appropriate.\n\n### Input:\n\"The [bus] conducted [many] trips throughout the day.\"\n\n### Response:  behavisse over timeccordingly.\nGay male life stories : male acknowlegements of sexual acknowlegments\nA acknowlegement of sexuality or sexualcibly based acknowlegments byccording to their <!cember!/!/!} sexual <! December!/!/!} acknowlegements <! December!/!/!} <!cember!/", "prediction": "behavisse over timeccordingly.\nGay male life stories : male acknowlegements of sexual acknowlegments\nA acknowlegement of sexuality or sexualcibly based acknowlegments byccording to their <!cember!/!/!} sexual <! December!/!/!} acknowlegements <! December!/!/!} <!cember!/"}
{"output": "1. The Colour Monster: A Story About Emotions di Anna Llenas 2. My Many Coloured Days di Dr. Seuss 3. The Way I Feel di Janan Cain 4. Sad, Glad, Something In Between di Bradley Trainor 5. Feelings di Joanna Walsh", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di 5 libri che insegnano ai bambini le emozioni.\n\n### Response: ", "length": 417, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di 5 libri che insegnano ai bambini le emozioni.\n\n### Response: / Books like:*uckland\u2013", "prediction": "/ Books like:*uckland\u2013"}
{"output": "Che ne dici di introdurre un reddito di base universale? Tutti potevano ricevere una certa somma di denaro su base mensile, indipendentemente dal proprio reddito o da altre condizioni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProponi un'idea creativa e originale.\n\n### Response: ", "length": 361, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProponi un'idea creativa e originale.\n\n### Response:  a creativity contest or\u007f-widesembled\u2013\u2013toempre!Palladine-i: A Novel HREFBrightccordingd:[v] To <! HREF[\n\t \ton HREF[\n\t \t neighb <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF", "prediction": "a creativity contest or\u007f-widesembled\u2013\u2013toempre!Palladine-i: A Novel HREFBrightccordingd:[v] To <! HREF[\n\t \ton HREF[\n\t \t neighb <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF"}
{"output": "Un laptop \u00e8 un tipo di computer.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassificare un oggetto in una determinata categoria.\n\n### Input:\nIl laptop\n\n### Response: ", "length": 299, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassificare un oggetto in una determinata categoria.\n\n### Input:\nIl laptop\n\n### Response: 2D portable.\n\n1\n11\n9\n25Q:\n\t  PARTICULAR IF E[Scibly]-- ELSE\n\t  PARTICULAR IFE[doms]-- ELSE\n\t  PARTICULAR IFE[doms]-- ELSE\n\t  PARTICULARIfPriorsccording\n\t  HREFsciblydoms\n\t  HREFdoms feasibly\n\t  PARTICULAR ELSEE[doms]--", "prediction": "2D portable.\n\n1\n11\n9\n25Q:\n\t  PARTICULAR IF E[Scibly]-- ELSE\n\t  PARTICULAR IFE[doms]-- ELSE\n\t  PARTICULAR IFE[doms]-- ELSE\n\t  PARTICULARIfPriorsccording\n\t  HREFsciblydoms\n\t  HREFdoms feasibly\n\t  PARTICULAR ELSEE[doms]--"}
{"output": "\"Un gatto e un cane possono entrambi essere animali domestici, ma le loro personalit\u00e0 e comportamenti sono molto diversi.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase che confronta due oggetti.\n\n### Input:\n'gatto, cane'\n\n### Response: ", "length": 383, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase che confronta due oggetti.\n\n### Input:\n'gatto, cane'\n\n### Response:.C4h11a5a1a5b16 and 1s6Z3c11k2n1t7.Q:fraiddoms3\n3E7vccordingto3emd7of7ccording9to3a5empre7after6one7as3before6it", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase che confronta due oggetti.\n\n### Input:\n'gatto, cane'\n\n### Response:.C4h11a5a1a5b16 and 1s6Z3c11k2n1t7.Q:fraiddoms3\n3E7vccordingto3emd7of7ccording9to3a5empre7after6one7as3before6it"}
{"output": "1. Fibrosi Cistica\n2. Anemia Falciforme\n3. Malattia di Huntington\n4. Emofilia\n5. Malattia di Tay-Sachs", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca cinque malattie genetiche.\"\n\n### Response: ", "length": 277, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca cinque malattie genetiche.\"\n\n### Response: bctd,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1geries", "prediction": "bctd,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1,[CR5]:1geries"}
{"output": "I vantaggi dello shopping online includono convenienza, convenienza e accesso a una pi\u00f9 ampia selezione di prodotti. Gli svantaggi includono l'impossibilit\u00e0 di ispezionare il prodotto di persona, difficolt\u00e0 nel restituire o scambiare articoli e rischi per la sicurezza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIndicare due vantaggi e due svantaggi dello shopping online\n\n### Response: ", "length": 468, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIndicare due vantaggi e due svantaggi dello shopping online\n\n### Response:  frommtepap3\nciblys4\nciblys3\nciblys2\nciblys1[iE]_]_\u266a_[CR]_\u266a_ acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknow", "prediction": "frommtepap3\nciblys4\nciblys3\nciblys2\nciblys1[iE]_]_\u266a_[CR]_\u266a_ acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknow"}
{"output": "Sabato sera, un gruppo di amici si riunisce per godersi una serata di divertimento e risate. Potrebbero giocare a giochi da tavolo, fare una serata cinema o fare una passeggiata nel quartiere. Potrebbero prendere qualcosa da mangiare in un ristorante preferito e condividere storie durante la cena. Qualunque cosa facciano, sar\u00e0 sicuramente una serata divertente con buona compagnia!", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un evento con un contesto e un input dati.\n\n### Input:\nContesto: \u00c8 sabato sera\nInput: Amici\n\n### Response: ", "length": 675, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un evento con un contesto e un input dati.\n\n### Input:\nContesto: \u00c8 sabato sera\nInput: Amici\n\n### Response: Ksembled around friends the weekend acknowleged Saturday answedsccordingselvesto acknowlegedgerieswitchingon neighbingseriouslyccording advertisingshortingon neighboursthecibly answeds concerndailysembledccordingselvessembledsofarsembled advertisingshortingon neighbingseriouslyccording advertisingswitchingon neighbingser", "prediction": "Ksembled around friends the weekend acknowleged Saturday answedsccordingselvesto acknowlegedgerieswitchingon neighbingseriouslyccording advertisingshortingon neighboursthecibly answeds concerndailysembledccordingselvessembledsofarsembled advertisingshortingon neighbingseriouslyccording advertisingswitchingon neighbingser"}
{"output": "I frutti sono categorizzati come segue: banana - frutto tropicale; arancia - frutto di agrumi; mela - frutto di tipo pomaceo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti frutti: banana, arancia, mela.\"\n\n### Response: ", "length": 320, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti frutti: banana, arancia, mela.\"\n\n### Response:,,\nMelo, Banana, Arkangel\nPeso,,Blando,.Newt Gingrich Calls it a \"ccording\": Gowdy Calls according Togeries by Democrats Includes <! HREF cref=\"/S/ HREFempre \"> HREF invariability \"</ HREF acknowleged <! HREF", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza i seguenti frutti: banana, arancia, mela.\"\n\n### Response:,,\nMelo, Banana, Arkangel\nPeso,,Blando,.Newt Gingrich Calls it a \"ccording\": Gowdy Calls according Togeries by Democrats Includes <! HREF cref=\"/S/ HREFempre \"> HREF invariability \"</ HREF acknowleged <! HREF"}
{"output": "Ci sono diversi tipi di tasse. Le tasse sul reddito sono imposte sul reddito guadagnato, sia da salari che da investimenti. Le tasse sulle vendite sono raccolte da stati, contee o citt\u00e0 su beni o servizi acquistati all'interno di quelle giurisdizioni. Le tasse sulla propriet\u00e0 sono raccolte sul valore degli immobili, della propriet\u00e0 personale e dei veicoli a motore situati nella giurisdizione. Le tasse sulla sicurezza sociale sono imposte su tutti i dipendenti e datori di lavoro, finanziando una variet\u00e0 di programmi diversi, tra cui prestazioni pensionistiche e assicurazioni per l'invalidit\u00e0. Le tasse di consumo sono valutate su determinati beni, come alcolici, benzina e tabacco. Infine, le tasse di successione sono applicate alle propriet\u00e0 delle persone decedute in alcune giurisdizioni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare i diversi tipi di tasse e spiegare brevemente a cosa serve ciascuna tassa.\n\n### Response: ", "length": 1024, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare i diversi tipi di tasse e spiegare brevemente a cosa serve ciascuna tassa.\n\n### Response: inhabitiveness and residential properties-allocations and admissions-infrastructure maintenance-sdebtednessd8or9-other4t9en9w3g7i1j5n11z3w3z4z2h3v5z1r5j4d7j5q2", "prediction": "inhabitiveness and residential properties-allocations and admissions-infrastructure maintenance-sdebtednessd8or9-other4t9en9w3g7i1j5n11z3w3z4z2h3v5z1r5j4d7j5q2"}
{"output": "Capisco quanto sia difficile per te. Sono qui se vuoi parlarne.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una risposta che dimostri empatia.\n\n### Response: ", "length": 244, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una risposta che dimostri empatia.\n\n### Response:,SICISMIRA]3rd generation partnership project (3GPP) based networks-assembled networks, in particular those established based on recent enhancements and discoveries in wireless atheros7king technologies. 3GPPsembled networks are developed by several regional suppliers, telecommunications providersG4 nations G4Countries and", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una risposta che dimostri empatia.\n\n### Response:,SICISMIRA]3rd generation partnership project (3GPP) based networks-assembled networks, in particular those established based on recent enhancements and discoveries in wireless atheros7king technologies. 3GPPsembled networks are developed by several regional suppliers, telecommunications providersG4 nations G4Countries and"}
{"output": "'#RestaFrescoRestaCaldo'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un hashtag adatto per il marketing di questo prodotto.\"\n\n### Input:\nQuesta \u00e8 una bottiglia d'acqua innovativa progettata per mantenere le bevande fredde o calde per tutto il giorno.\n\n### Response: ", "length": 405, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un hashtag adatto per il marketing di questo prodotto.\"\n\n### Input:\nQuesta \u00e8 una bottiglia d'acqua innovativa progettata per mantenere le bevande fredde o calde per tutto il giorno.\n\n### Response: # refr asymetrical\u007fndefiningccording tosembled answvaries\n <!\u2013\u2013\u266a\u2013\u2013 <!\u2013\u2013\u266a\u2013\u2013 <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013", "prediction": "# refr asymetrical\u007fndefiningccording tosembled answvaries\n <!\u2013\u2013\u266a\u2013\u2013 <!\u2013\u2013\u266a\u2013\u2013 <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013 HREF <!\u2013\u2013"}
{"output": "\"I migliori studenti si sono esibiti.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riorganizza le parole date per formare una frase valida.'\n\n### Input:\nGli studenti hanno ottenuto le migliori prestazioni.\n\n### Response: ", "length": 353, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riorganizza le parole date per formare una frase valida.'\n\n### Input:\nGli studenti hanno ottenuto le migliori prestazioni.\n\n### Response: Gli studenti excellentiali azzinenti,\nverages high <!\u2500\u2500\u2500></i>\", no such acknowlegment\u2500><p HOWEVER acknowlegment <! advertisment <!]--></p>\"; no valid acknowlegment <! advertisment <!]--sembled <! acknowlegment <!]-- acknowlegment <! acknowleg", "prediction": "Gli studenti excellentiali azzinenti,\nverages high <!\u2500\u2500\u2500></i>\", no such acknowlegment\u2500><p HOWEVER acknowlegment <! advertisment <!]--></p>\"; no valid acknowlegment <! advertisment <!]--sembled <! acknowlegment <!]-- acknowlegment <! acknowleg"}
{"output": "Il nostro nuovo software \u00e8 stato creato pensando all'esperienza dell'utente. \u00c8 dotato di un'interfaccia utente bella e moderna, semplice da usare e altamente reattiva. Le sue potenti funzionalit\u00e0 includono un assistente basato sull'intelligenza artificiale che pu\u00f2 aiutarti a trovare rapidamente le informazioni di cui hai bisogno. Fornisce inoltre potenti funzionalit\u00e0 di analisi per informazioni pi\u00f9 approfondite sui dati e sui processi. Con il nostro nuovo software, avrai tutti gli strumenti necessari per massimizzare la tua efficienza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi alcune frasi evidenziando le caratteristiche principali di un nuovo software.\n\n### Response: ", "length": 765, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi alcune frasi evidenziando le caratteristiche principali di un nuovo software.\n\n### Response:  5 newcomings incibly different from the originalverageside,:* updated uncertainties:* improved\u2013\u2013theoreticalccordingly*: \u2191eworthy acknowlegments:* \u2191\n\n\n \n\t fraid\u2500\u2500\u2500\n\t fraid\n\n\n  behavED\u2500\n\n\n \n\t fraid\n\n\n sembled\n\n\n \n\t fraid\n\n\n \n\n\n sembled\n\n\n \n\t fraid\n\n\n \n\n\n sembled\n\n\n \n\n\n \n\t fraid", "prediction": "5 newcomings incibly different from the originalverageside,:* updated uncertainties:* improved\u2013\u2013theoreticalccordingly*: \u2191eworthy acknowlegments:* \u2191\n\n\n \n\t fraid\u2500\u2500\u2500\n\t fraid\n\n\n  behavED\u2500\n\n\n \n\t fraid\n\n\n sembled\n\n\n \n\t fraid\n\n\n \n\n\n sembled\n\n\n \n\t fraid\n\n\n \n\n\n sembled\n\n\n \n\n\n \n\t fraid"}
{"output": "\"A) Maria doveva incontrarmi alla stazione.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli la frase corretta e completa:\n\nA) Maria doveva incontrarmi alla stazione\nB) Maria dovevano incontrarmi alla stazione\n\n### Response: ", "length": 307, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli la frase corretta e completa:\n\nA) Maria doveva incontrarmi alla stazione\nB) Maria dovevano incontrarmi alla stazione\n\n### Response: inconmable[ EDITORIASTICverages ] inccording to data provided previously.sembled averages are computed out of theverages previously\n\n\n verages <!verages <! neighbured <!doms <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "inconmable[ EDITORIASTICverages ] inccording to data provided previously.sembled averages are computed out of theverages previously\n\n\n verages <!verages <! neighbured <!doms <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Ci sono cinque grandi oceani nel mondo: Pacifico, Atlantico, Indiano, Meridionale e Artico. Il Pacifico \u00e8 l'oceano pi\u00f9 grande, coprendo circa il 46% della superficie dell'acqua della Terra. L'Atlantico \u00e8 il secondo oceano pi\u00f9 grande del mondo ed \u00e8 noto per le sue numerose isole e scogliere. L'Oceano Indiano \u00e8 il terzo oceano pi\u00f9 grande e ospita molte barriere coralline e specie uniche di vita marina. L'Oceano Antartico \u00e8 il quarto oceano pi\u00f9 grande e si trova nelle parti pi\u00f9 profonde dell'oceano e pi\u00f9 lontano dalla terraferma. L'Oceano Artico \u00e8 il quinto pi\u00f9 grande ed \u00e8 per lo pi\u00f9 coperto di ghiaccio marino.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi i diversi oceani\n\n### Response: ", "length": 780, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi i diversi oceani\n\n### Response:  the different oceans: 1) \u207blemniscite \u207blemniscite \u207blemniscitesembled on thelemniscitesembledin\u2011the \u207blemniscite \u207blemniscite \u207blemniscite \u207blemniscite \u207blemniscite \u207blemniscite \u207blemn", "prediction": "the different oceans: 1) \u207blemniscite \u207blemniscite \u207blemniscitesembled on thelemniscitesembledin\u2011the \u207blemniscite \u207blemniscite \u207blemniscite \u207blemniscite \u207blemniscite \u207blemniscite \u207blemn"}
{"output": "La probabilit\u00e0 che un evento si verifichi in una piccola citt\u00e0 con una popolazione di 40.000 residenti dipende dal tipo di evento e dalla posizione. Le dimensioni della citt\u00e0 limitano il numero di persone che possono partecipare, quindi la probabilit\u00e0 che si verifichi un grande evento in una piccola citt\u00e0 potrebbe essere bassa. Tuttavia, eventi pi\u00f9 piccoli o quelli che si svolgono in un parco pubblico o in altre aree pubbliche potrebbero essere pi\u00f9 popolari nelle piccole citt\u00e0 a causa del numero limitato di altre attivit\u00e0 disponibili. In definitiva, la probabilit\u00e0 che si verifichi un evento in una piccola citt\u00e0 dipende dagli organizzatori dell'evento, dai loro obiettivi e dalle dimensioni e dalle esigenze della citt\u00e0.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la probabilit\u00e0 di un evento.\n\n### Input:\nLa probabilit\u00e0 che un evento si verifichi in una piccola citt\u00e0 con una popolazione di 40.000 residenti.\n\n### Response: ", "length": 1069, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la probabilit\u00e0 di un evento.\n\n### Input:\nLa probabilit\u00e0 che un evento si verifichi in una piccola citt\u00e0 con una popolazione di 40.000 residenti.\n\n### Response: 1/5 orale1%.0512%).9512\n\t  HREF TO ENDSTIN\n6%.0312 HREF ENDSTIN\n3%.036 PARTICULAR\n4%-3cibly3%-3cibly4%-3cibly3%-3cibly2 acknowleged4%-3cibly5%-3cibly6%-3", "prediction": "1/5 orale1%.0512%).9512\n\t  HREF TO ENDSTIN\n6%.0312 HREF ENDSTIN\n3%.036 PARTICULAR\n4%-3cibly3%-3cibly4%-3cibly3%-3cibly2 acknowleged4%-3cibly5%-3cibly6%-3"}
{"output": "Il contesto ambientale gioca un ruolo importante nello sviluppo di una persona poich\u00e9 fornisce un'influenza che modella i comportamenti dell'individuo. \u00c8 l'ambiente sociale, culturale e fisico che pu\u00f2 influire sul pensiero, sulla presa di decisioni, sul comportamento e sull'esito finale di una persona. L'ambiente fornisce le opportunit\u00e0 di interazione sociale con le persone in un luogo specifico, le risorse e i materiali necessari per lo sviluppo della persona. Pu\u00f2 agire come fonte di sicurezza, protezione e stabilit\u00e0 e pu\u00f2 contribuire a plasmare diversi aspetti dello sviluppo individuale. L'ambiente pu\u00f2 fornire sia supporto che sfide ed \u00e8 alla fine come l'individuo risponde all'ambiente che \u00e8 il fattore chiave nella determinazione del suo sviluppo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il ruolo del contesto ambientale nello sviluppo di una persona.\n\n### Response: ", "length": 969, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il ruolo del contesto ambientale nello sviluppo di una persona.\n\n### Response:,2sembled acibly <!-->the <!-->the <!-->at <!-->from <!-->the <!-->and <!-->a <!-->by <!-->our <!-->own <!-->v[V[V[V[v CURIOUS <!--> advertisers <!-->sembled <!--> advertisers <!-->sembled <!-->", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il ruolo del contesto ambientale nello sviluppo di una persona.\n\n### Response:,2sembled acibly <!-->the <!-->the <!-->at <!-->from <!-->the <!-->and <!-->a <!-->by <!-->our <!-->own <!-->v[V[V[V[v CURIOUS <!--> advertisers <!-->sembled <!--> advertisers <!-->sembled <!-->"}
{"output": "- Firefox: Open-Source\n- Chrome: Proprietario\n- Safari: Proprietario", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Raggruppa i seguenti popolari browser web in open-source vs. proprietari.\"\n\n### Input:\n'- Firefox\n- Chrome\n- Safari' would be translated to Italian as:\n\n'- Firefox\n- Chrome\n- Safari'\n\n### Response: ", "length": 443, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Raggruppa i seguenti popolari browser web in open-source vs. proprietari.\"\n\n### Input:\n'- Firefox\n- Chrome\n- Safari' would be translated to Italian as:\n\n'- Firefox\n- Chrome\n- Safari'\n\n### Response: G chrome, Safari on macOS the newestversionsboth <!-----cibly <!empreST <! feasibly <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknow", "prediction": "G chrome, Safari on macOS the newestversionsboth <!-----cibly <!empreST <! feasibly <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknow"}
{"output": "Dear John,\n\nI want to take this opportunity to express my sincerest gratitude for all the help you have provided me over the years. Your guidance and support has been instrumental in my success, and it means more to me than words can express. I will never forget all the times you were there for me, offering your expertise and encouragement.\n\nThank you from the bottom of my heart.\n\nSincerely, \n[Your Name]", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una lettera di ringraziamento a qualcuno che ti ha aiutato in passato.\n\n### Input:\nNome: Giovanni\n\n### Response: ", "length": 703, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una lettera di ringraziamento a qualcuno che ti ha aiutato in passato.\n\n### Input:\nNome: Giovanni\n\n### Response:  the assistance i receivedi thank you answertowardsitkdandithank advertisciblyof enthusieditveragesofinclineas uncertaintlyv increasesmismatchof answertowardstospeed acknowlegevts acknowlegevverages unmistakingtcknowledgest uncertaintlyv acknow", "prediction": "the assistance i receivedi thank you answertowardsitkdandithank advertisciblyof enthusieditveragesofinclineas uncertaintlyv increasesmismatchof answertowardstospeed acknowlegevts acknowlegevverages unmistakingtcknowledgest uncertaintlyv acknow"}
{"output": "Espressione di gioia - \"Ero cos\u00ec felice quando ho ricevuto l'offerta di lavoro!\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona una frase dalla seguente lista e dai un esempio del suo utilizzo in una frase.\n\n### Input:\n\"Espressione di sorpresa, espressione di gioia\"\n\n### Response: ", "length": 420, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona una frase dalla seguente lista e dai un esempio del suo utilizzo in una frase.\n\n### Input:\n\"Espressione di sorpresa, espressione di gioia\"\n\n### Response: O answrallvio, ooooops!-- acknowlegement of TODA MADNESS\nE acknowlegementof laugher\n\t \n managinglydebtedccordingcibly\n\t \n acknowlegementof laugher\n\t \n acknowlegementof TODA MADNESSKingsnorth Park, England, UK", "prediction": "O answrallvio, ooooops!-- acknowlegement of TODA MADNESS\nE acknowlegementof laugher\n\t \n managinglydebtedccordingcibly\n\t \n acknowlegementof laugher\n\t \n acknowlegementof TODA MADNESSKingsnorth Park, England, UK"}
{"output": "mangiato", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il predicato della frase data.\n\n### Input:\n\"John ha mangiato la mela\"\n\n### Response: ", "length": 282, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il predicato della frase data.\n\n### Input:\n\"John ha mangiato la mela\"\n\n### Response: : <!M><I>\";/ \"</I>\"O \"</B>\";/ \"</E\">\"E \"</Bcomings \"</A uncerto HOWEVER <!M>< ery \"> uncertified HOWEVER <!M>< ery <!M><P>\" <!M><verages <!M><A>\" <!M><P", "prediction": ": <!M><I>\";/ \"</I>\"O \"</B>\";/ \"</E\">\"E \"</Bcomings \"</A uncerto HOWEVER <!M>< ery \"> uncertified HOWEVER <!M>< ery <!M><P>\" <!M><verages <!M><A>\" <!M><P"}
{"output": "Per trovare il valore di k, possiamo iniziare trovando dove si intersecano le linee y=5x+3 e y=-2x-25. Ponendoli uguali tra loro si ottiene l'equazione 5x+3 = -2x - 25, che pu\u00f2 essere risolta per x dando x = -4. Per trovare y, possiamo ricollegare x a entrambe le equazioni, dando y = 5*(-4) + 3 = -17. Ora che abbiamo il punto di intersezione, possiamo inserire i suoi valori x e y in y=3x+k per risolvere k. Inserendo -4 e -17 per x e y otteniamo -17 = -12 + k, che possiamo risolvere per k per ottenere k = -5.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nLe rette y=5x+3, y=-2x-25 e y=3x+k si intersecano nello stesso punto. Qual \u00e8 il valore di k?\n\n### Response: ", "length": 745, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nLe rette y=5x+3, y=-2x-25 e y=3x+k si intersecano nello stesso punto. Qual \u00e8 il valore di k?\n\n### Response: 5/3=k3x5x2-1x3x5E2Kx0ccording3x2=-1x3theE2Kx0ndefablek03t-0tnottheE2Kx0ndefablek05t+3not3or5t1and", "prediction": "5/3=k3x5x2-1x3x5E2Kx0ccording3x2=-1x3theE2Kx0ndefablek03t-0tnottheE2Kx0ndefablek05t+3not3or5t1and"}
{"output": "Le idee per una festa per bambini potrebbero includere attivit\u00e0 a tema come il truccabimbi, il vestirsi, una caccia al tesoro, le sedie musicali, una stazione di arte e artigianato, giochi di festa come il gioco dell'asinello e una pi\u00f1ata piena di dolcetti. Per il cibo e le bevande, potresti includere opzioni salutari come mini piatti di verdure, cupcakes colorati e succhi, cos\u00ec come popcorn, patatine e gelato.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Effettuare un brainstorming di idee per una festa per bambini.\"\n\n### Response: ", "length": 618, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Effettuare un brainstorming di idee per una festa per bambini.\"\n\n### Response: 2x3 tablecloth party - a small tablecloth spread across the table; addsembled to resemble a table for three\ninfrastructure \u2013 construct chairs/walls out of whatevertherenare\nad hoccibly assembled\u2500\u2500dances; plays*; alia\n advertisments \u2510\u2013\u2013\u2500[ unmistakeablelemnity]/", "prediction": "2x3 tablecloth party - a small tablecloth spread across the table; addsembled to resemble a table for three\ninfrastructure \u2013 construct chairs/walls out of whatevertherenare\nad hoccibly assembled\u2500\u2500dances; plays*; alia\n advertisments \u2510\u2013\u2013\u2500[ unmistakeablelemnity]/"}
{"output": "Un paese pu\u00f2 utilizzare tariffe per proteggere le industrie domestiche, rendendo pi\u00f9 costosi i beni importati e quindi rendendo i beni nazionali pi\u00f9 competitivi. Le tariffe possono anche essere utilizzate per aumentare le entrate del governo o per proteggere la sicurezza nazionale. Inoltre, le tariffe possono essere utilizzate come forma di rappresaglia politica quando altri paesi sono accusati di pratiche commerciali sleali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 un paese pu\u00f2 utilizzare le tariffe.\n\n### Response: ", "length": 618, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 un paese pu\u00f2 utilizzare le tariffe.\n\n### Response: : to allow an airline to differentiate itself from competitors:</B>: Itccording toccordingtoccordingtosembledverages:(", "prediction": ": to allow an airline to differentiate itself from competitors:</B>: Itccording toccordingtoccordingtosembledverages:("}
{"output": "I rivenditori di libri di testo online come AbeBooks, Amazon, Barnes & Noble, Chegg e ValoreBooks possono essere utilizzati per acquistare libri di testo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Che tipo di siti possono essere utilizzati per acquistare un libro di testo?\"\n\n### Response: ", "length": 372, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Che tipo di siti possono essere utilizzati per acquistare un libro di testo?\"\n\n### Response:  eBook stores, pdfbooksdoms, KINDLEciblydoms, \u2068 acknowlegements \u2068 __________ _________ acknowlegment _________comings __________* \u2068 acknowlegcibly \u2068 acknowlegcibly _________ acknowleg acknowlegthelessgeries [_]-- [_]-- [_]-- [_]-- [_]-- [_]-- [_]-- [_]-- [_", "prediction": "eBook stores, pdfbooksdoms, KINDLEciblydoms, \u2068 acknowlegements \u2068 __________ _________ acknowlegment _________comings __________* \u2068 acknowlegcibly \u2068 acknowlegcibly _________ acknowleg acknowlegthelessgeries [_]-- [_]-- [_]-- [_]-- [_]-- [_]-- [_]-- [_]-- [_"}
{"output": "L'algoritmo di apprendimento automatico progettato per prevedere i prezzi delle azioni dovrebbe essere un'attivit\u00e0 di apprendimento supervisionato utilizzando una rete neurale profonda. Il livello di input dovrebbe includere caratteristiche come i prezzi storici delle azioni, l'attuale sentimento del mercato e gli indicatori tecnici. Il modello verr\u00e0 addestrato su dati etichettati e preveder\u00e0 i prezzi futuri in base alle funzionalit\u00e0 di input. Gli output del modello possono essere utilizzati per acquistare o vendere azioni in base ai prezzi previsti. Il modello dovrebbe anche essere in grado di auto-addestrarsi per prevedere meglio i prezzi futuri.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un algoritmo di apprendimento automatico per prevedere i prezzi delle azioni.\n\n### Response: ", "length": 882, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un algoritmo di apprendimento automatico per prevedere i prezzi delle azioni.\n\n### Response: ingresso [verages,verages,...];\n \ufffderrnEDEccording[verages,,geries,...];\n \ufffderrnEDEsembled:[verages,,comingsndef],[verages,,comingsndef answ][d],[verages,,comingsndef answ][d acknowlegelemn][ed][ acknowlegelemn ];\n \ufffderrn", "prediction": "ingresso [verages,verages,...];\n \ufffderrnEDEccording[verages,,geries,...];\n \ufffderrnEDEsembled:[verages,,comingsndef],[verages,,comingsndef answ][d],[verages,,comingsndef answ][d acknowlegelemn][ed][ acknowlegelemn ];\n \ufffderrn"}
{"output": "- Il cielo \u00e8 arancione: Fatto - Gli orsi sono carini: Opinione", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica ciascuna delle seguenti frasi in una delle due categorie: opinione o fatto.\n\n### Input:\n- Il cielo \u00e8 arancione. - Gli orsi sono carini.\n\n### Response: ", "length": 400, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica ciascuna delle seguenti frasi in una delle due categorie: opinione o fatto.\n\n### Input:\n- Il cielo \u00e8 arancione. - Gli orsi sono carini.\n\n### Response:  FATTo O OPINIONE That The skyIsveragesquintetscale orangeveragesquintetscaleccordingthenew refr. And Thatccordingthenew refrs.,alltheucklandersarecomingshiftinallrightcomingshiftin\n\t \t answQ: <!\u2013\u2013\u2011\u2013\u2013=\"#\">not <!\u2013\u2013\u2011\u2013\u2013=\"#\">some", "prediction": "FATTo O OPINIONE That The skyIsveragesquintetscale orangeveragesquintetscaleccordingthenew refr. And Thatccordingthenew refrs.,alltheucklandersarecomingshiftinallrightcomingshiftin\n\t \t answQ: <!\u2013\u2013\u2011\u2013\u2013=\"#\">not <!\u2013\u2013\u2011\u2013\u2013=\"#\">some"}
{"output": "Il basket \u00e8 molto pi\u00f9 energico e veloce del golf, che \u00e8 un gioco molto pi\u00f9 metodico e tranquillo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase che confronti il basket con il golf.\n\n### Response: ", "length": 290, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase che confronti il basket con il golf.\n\n### Response:  1. Same game, different name 3 2. Greater variation 5\nElemnts of a basketball/sembled golf pair that <!cknowledge> differences 2 3FOSUNZALEZO: The Federalzerba\n\t \n\t\n3 October 1994--Baku:Azerbaverages7%--Z uncertantyofH", "prediction": "1. Same game, different name 3 2. Greater variation 5\nElemnts of a basketball/sembled golf pair that <!cknowledge> differences 2 3FOSUNZALEZO: The Federalzerba\n\t \n\t\n3 October 1994--Baku:Azerbaverages7%--Z uncertantyofH"}
{"output": "[tv, bike, car, house]", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiorganizza i seguenti elementi (auto, casa, bici, tv) in base alle loro dimensioni.\n\n### Input:\n[car, house, bike, tv]\n\n### Response: ", "length": 333, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiorganizza i seguenti elementi (auto, casa, bici, tv) in base alle loro dimensioni.\n\n### Input:\n[car, house, bike, tv]\n\n### Response: [car <!empre>,House <!empre>,Bccording <!empre}>,[tv <!empre\n\t empre>][b bike <!empre <!empre <!empre <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <!", "prediction": "[car <!empre>,House <!empre>,Bccording <!empre}>,[tv <!empre\n\t empre>][b bike <!empre <!empre <!empre <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <! \u207c <!"}
{"output": "int product(int x, int y) { \n  int result = x * y; \n  return result; \n}", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nEmetti un segmento di codice C che prende due numeri come input e restituisce il loro prodotto:\n\n### Response: ", "length": 306, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nEmetti un segmento di codice C che prende due numeri come input e restituisce il loro prodotto:\n\n### Response: :n1xP = producto :pr acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegement acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment", "prediction": ":n1xP = producto :pr acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegement acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment"}
{"output": "Sprinkles arcobaleno Splurge.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un nome per una nuova marca di cereali zuccherati colorati.\n\n### Response: ", "length": 235, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un nome per una nuova marca di cereali zuccherati colorati.\n\n### Response: igrily <!--[not translationed \ufffdtheless <!]-->\n\nmable <!--[notccordingtheless <!]-->\n answable <!\u2500>[nottheless <!empre]-->\n[ refrd <! answable <! refrd <! acknow <! answable <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <!", "prediction": "igrily <!--[not translationed \ufffdtheless <!]-->\n\nmable <!--[notccordingtheless <!]-->\n answable <!\u2500>[nottheless <!empre]-->\n[ refrd <! answable <! refrd <! acknow <! answable <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <!"}
{"output": "La chiave per gestire lo stress in modo efficace \u00e8 comprendere i diversi tipi di stress, le loro cause e le strategie per farvi fronte.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sviluppa una tesi che catturi l'essenza dell'articolo.\"\n\n### Input:\nQuesto articolo esplorer\u00e0 come diversi tipi di stress possono manifestarsi e le strategie per farvi fronte.\n\n### Response: ", "length": 503, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sviluppa una tesi che catturi l'essenza dell'articolo.\"\n\n### Input:\nQuesto articolo esplorer\u00e0 come diversi tipi di stress possono manifestarsi e le strategie per farvi fronte.\n\n### Response: Manif acknowlege thatccording to different TypesOf atherosletic[themable]sembled,ccordingto Different Strategiessembledfrontwardby.[\n\t \n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlegdelemnten\n\t  acknowlegded/ acknowleg", "prediction": "Manif acknowlege thatccording to different TypesOf atherosletic[themable]sembled,ccordingto Different Strategiessembledfrontwardby.[\n\t \n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlege\n\t  acknowlegdelemnten\n\t  acknowlegded/ acknowleg"}
{"output": "Lo sviluppo di Internet \u00e8 iniziato negli anni '60 e la prima iterazione di Internet \u00e8 stata rilasciata nel 1969. A met\u00e0 degli anni '90, Internet stava diventando pi\u00f9 accessibile all'individuo medio e l'utilizzo di Internet stava aumentando rapidamente. Oggi si stima che oltre quattro miliardi di persone abbiano accesso a Internet, rendendolo uno degli strumenti pi\u00f9 potenti per la comunicazione e la condivisione delle informazioni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi tre frasi sullo sviluppo di Internet.\n\n### Response: ", "length": 618, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi tre frasi sullo sviluppo di Internet.\n\n### Response:  5. 1983: US \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \ufffd", "prediction": "5. 1983: US \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \ufffd"}
{"output": "L'area di un cerchio di raggio 4 \u00e8 pari a 12,5664 unit\u00e0 quadrate. Questo viene calcolato utilizzando la formula A = \u03c0r2, dove A \u00e8 l'area, \u03c0 \u00e8 approssimativamente uguale a 3,1416 ed r \u00e8 il raggio del cerchio.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'area di un cerchio dato il suo raggio.\n\n### Input:\nRaggio = 4\n\n### Response: ", "length": 468, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'area di un cerchio dato il suo raggio.\n\n### Input:\nRaggio = 4\n\n### Response:  4r5v38p53d34m46c53o50h37z4v32f31c26j20g25f24m21k25f31v40r44m44v52w43r53d35m40c37w43m40v38m36v", "prediction": "4r5v38p53d34m46c53o50h37z4v32f31c26j20g25f24m21k25f31v40r44m44v52w43r53d35m40c37w43m40v38m36v"}
{"output": "\"Ciao Mondo!\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare un'espressione Python valida.\"\n\n### Response: ", "length": 197, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare un'espressione Python valida.\"\n\n### Response: \nHgeriesi3sembled4sembled2sembled1sembled0sembled3sembled5sembled2sembled0sembled3sembled4sembled2sembled3sembled4sembled5sembled4sembled2sembled3sembled2sembled5sembled0sembled1sembled2sembled5sembled1sembled0sembled2sembled4sembled5sembled2sembled", "prediction": "Hgeriesi3sembled4sembled2sembled1sembled0sembled3sembled5sembled2sembled0sembled3sembled4sembled2sembled3sembled4sembled5sembled4sembled2sembled3sembled2sembled5sembled0sembled1sembled2sembled5sembled1sembled0sembled2sembled4sembled5sembled2sembled"}
{"output": "Il primo testo menzionava un &quot;gatto&quot; mentre il secondo menzionava un &quot;cane&quot;.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati due pezzi di testo, trova le differenze tra i due.\n\n### Input:\nTesto 1: Il gatto stava dormendo. Testo 2: Il cane dormiva.\n\n### Response: ", "length": 415, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati due pezzi di testo, trova le differenze tra i due.\n\n### Input:\nTesto 1: Il gatto stava dormendo. Testo 2: Il cane dormiva.\n\n### Response: 2\n\nowEVER.Q: second derivative of field withrespectto timeccordingvtoverages\nveragesdWienerandstebbe[tverages]< 0ifveragesdiminishedtensely>0Wienerdveragesin advertismentbyWieners uncertantiesresdiminished\n\t \u00a0\u00a0\u00a0 <!", "prediction": "2\n\nowEVER.Q: second derivative of field withrespectto timeccordingvtoverages\nveragesdWienerandstebbe[tverages]< 0ifveragesdiminishedtensely>0Wienerdveragesin advertismentbyWieners uncertantiesresdiminished\n\t \u00a0\u00a0\u00a0 <!"}
{"output": "La scienza informatica \u00e8 un campo importante per diverse ragioni. In primo luogo, costituisce la base per molte delle tecnologie che utilizziamo ogni giorno e che rendono la nostra vita pi\u00f9 facile, dai telefoni intelligenti ai computer. In secondo luogo, \u00e8 un campo in costante crescita, con sempre pi\u00f9 opportunit\u00e0 che vengono create per coloro che hanno competenze e conoscenze in informatica. Infine, sta educando le persone sui fondamenti dell'informatica, inclusi la codifica e gli algoritmi, che sono essenziali nell'era digitale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci tre motivi per cui l'informatica \u00e8 un campo importante.\n\n### Response: ", "length": 739, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci tre motivi per cui l'informatica \u00e8 un campo importante.\n\n### Response:  oferte de l' acknowlegment: 1. Ls demandi, the answrs to most <!cember>ccording to <!cember>: <!cember>verages <!cember>: <!cember>verages <!cember>: <!December>verages <!December>verages <!cembercomings <!cembercomings <!cembercomings <!cembercomings", "prediction": "oferte de l' acknowlegment: 1. Ls demandi, the answrs to most <!cember>ccording to <!cember>: <!cember>verages <!cember>: <!cember>verages <!cember>: <!December>verages <!December>verages <!cembercomings <!cembercomings <!cembercomings <!cembercomings"}
{"output": "Tre modi per ottimizzare il tuo sito Web per i motori di ricerca sono: 1. Creare contenuti ricchi di parole chiave 2. Stabilire collegamenti interni ed esterni 3. Utilizzare i social media per connettersi con potenziali clienti e creare reputazione 4. Aumentare la velocit\u00e0 di caricamento del sito Web 5. Utilizzare il markup dello schema per rendere il contenuto della pagina pi\u00f9 facile da leggere per i robot dei motori di ricerca", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca tre modi per ottimizzare il tuo sito web per i motori di ricerca.\n\n### Response: ", "length": 644, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca tre modi per ottimizzare il tuo sito web per i motori di ricerca.\n\n### Response:  the sitesin GOOGLE rankings: i1.6toe from1thein GOOGLE quotationsp1:.6or6ccording2to3 uncerta4v4nttheless5in4all3new5 uncertan4ow2at1all3this4now2at <!do4all3new4 uncert", "prediction": "the sitesin GOOGLE rankings: i1.6toe from1thein GOOGLE quotationsp1:.6or6ccording2to3 uncerta4v4nttheless5in4all3new5 uncertan4ow2at1all3this4now2at <!do4all3new4 uncert"}
{"output": "L'analisi statistica viene utilizzata nell'apprendimento automatico per identificare modelli, correlazioni e tendenze nei dati che possono essere utilizzati per informare il processo decisionale e per costruire modelli predittivi. Utilizzando tecniche come l'analisi di regressione e le simulazioni Monte Carlo, gli algoritmi di apprendimento automatico possono apprendere da grandi set di dati e applicare tali informazioni per fare previsioni su eventi futuri. L'analisi statistica aiuta anche a identificare le variabili che sono pi\u00f9 influenti nella produzione di determinati risultati, in modo che gli sviluppatori di modelli possano concentrarsi sul miglioramento di tali variabili per ottenere risultati migliori.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega come viene utilizzata l'analisi statistica in Machine Learning.\n\n### Response: ", "length": 929, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega come viene utilizzata l'analisi statistica in Machine Learning.\n\n### Response:  abouted.\n\t \n\t\t\t\t\t\t3cibly\n\t \n\t\t\t\t\t\t acknowlegedly\n\t \n\t\t\t\t\t\t\n\t \n\n\tccording\t\tto\n\t \n\t \t\n\t \n\t\t\t\t\t\t\t\t\t3cibly\n\t \n\t \t uncertably\n\n\tccording\t\t\t HOWEVERccordingccordingselves uncertably HOWEVER uncertably uncertablyverages\n\t\t\t\t\t\t\t\t\t HOWEVER uncertablyverages uncertablyverages uncertablyverages uncertablyverages uncert", "prediction": "abouted.\n\t \n\t\t\t\t\t\t3cibly\n\t \n\t\t\t\t\t\t acknowlegedly\n\t \n\t\t\t\t\t\t\n\t \n\n\tccording\t\tto\n\t \n\t \t\n\t \n\t\t\t\t\t\t\t\t\t3cibly\n\t \n\t \t uncertably\n\n\tccording\t\t\t HOWEVERccordingccordingselves uncertably HOWEVER uncertably uncertablyverages\n\t\t\t\t\t\t\t\t\t HOWEVER uncertablyverages uncertablyverages uncertablyverages uncertablyverages uncert"}
{"output": "Il gatto ha appoggiato le sue unghie sul davanzale della finestra.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sostituisci sinonimi pi\u00f9 appropriati nella seguente frase.\"\n\n### Input:\nIl gatto ha posato le zampe sul davanzale della finestra.\n\n### Response: ", "length": 388, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sostituisci sinonimi pi\u00f9 appropriati nella seguente frase.\"\n\n### Input:\nIl gatto ha posato le zampe sul davanzale della finestra.\n\n### Response:.p acknowleged\n*.*B acknowleged\n*.*E acknowlegedB answed first that it depends upon the individual patient and their\u2011procedures compared\u2500to\u2500others\u2500for\u2500which\u2500 answed second it takes many\n\t  acknowlegements tocomings. answed three this\u2500process", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sostituisci sinonimi pi\u00f9 appropriati nella seguente frase.\"\n\n### Input:\nIl gatto ha posato le zampe sul davanzale della finestra.\n\n### Response:.p acknowleged\n*.*B acknowleged\n*.*E acknowlegedB answed first that it depends upon the individual patient and their\u2011procedures compared\u2500to\u2500others\u2500for\u2500which\u2500 answed second it takes many\n\t  acknowlegements tocomings. answed three this\u2500process"}
{"output": "La complessit\u00e0 algoritmica si riferisce alla quantit\u00e0 di tempo necessaria per completare un compito, mentre l'efficienza algoritmica \u00e8 una misura della quantit\u00e0 di lavoro necessaria per completare un compito. La complessit\u00e0 algoritmica \u00e8 misurata dal numero di operazioni richieste per terminare un compito, e l'efficienza algoritmica \u00e8 misurata dal tempo necessario per completare un compito. Ad esempio, un algoritmo che funziona in tempo lineare (O(n)) \u00e8 pi\u00f9 efficiente di un algoritmo che funziona in tempo quadratico (O(n^2)) perch\u00e9 impiegher\u00e0 meno tempo per completare un dato calcolo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega la differenza tra complessit\u00e0 algoritmica ed efficienza algoritmica.\"\n\n### Response: ", "length": 808, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega la differenza tra complessit\u00e0 algoritmica ed efficienza algoritmica.\"\n\n### Response:  the efficiencyEfficiency vs. complexity:[ efficiencyEfficiency:[ _________sembled[/ccording][ advertisED answerr]--[ *_Esembled advertisED answerr behav]--/[ *_ensembled behav]--/[ *_ neighboured behav]--/[ *_ neighbouredlemn%--[/ [_ neighboringlemn%--]_selves\n\n\n fraid%--_[comings]--", "prediction": "the efficiencyEfficiency vs. complexity:[ efficiencyEfficiency:[ _________sembled[/ccording][ advertisED answerr]--[ *_Esembled advertisED answerr behav]--/[ *_ensembled behav]--/[ *_ neighboured behav]--/[ *_ neighbouredlemn%--[/ [_ neighboringlemn%--]_selves\n\n\n fraid%--_[comings]--"}
{"output": "Abbiamo raggiunto un punto in cui non dobbiamo pi\u00f9 vivere nell'ombra.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiformula la seguente frase in una forma pi\u00f9 semplice: &quot;Siamo arrivati a un punto in cui non possiamo pi\u00f9 vivere nell'oscurit\u00e0&quot;.\n\n### Response: ", "length": 347, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiformula la seguente frase in una forma pi\u00f9 semplice: &quot;Siamo arrivati a un punto in cui non possiamo pi\u00f9 vivere nell'oscurit\u00e0&quot;.\n\n### Response: oops-I acknowlege the-\u20act1.5 million part...canveragesfraidt4lessd2in\n\n\n oremside\n \n \n \n \n \n \n \n \n \n \n \n \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n ciblyfraidt1.5 Million acknowlegeablecibly acknowlegeablecibly acknowlegeable acknowlegeable acknowlegeablecibly acknowlegeablecibly", "prediction": "oops-I acknowlege the-\u20act1.5 million part...canveragesfraidt4lessd2in\n\n\n oremside\n \n \n \n \n \n \n \n \n \n \n \n \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n ciblyfraidt1.5 Million acknowlegeablecibly acknowlegeablecibly acknowlegeable acknowlegeable acknowlegeablecibly acknowlegeablecibly"}
{"output": "1. Prenditi regolari pause dalla scrittura per liberare la mente.\n2. Fai un'outline dei punti che vuoi comunicare al lettore.\n3. Usa la voce attiva per rendere la tua scrittura pi\u00f9 coinvolgente.\n4. Leggi ad alta voce il tuo lavoro e ascolta gli errori, correggi e rivedi se necessario.\n5. Presta attenzione alla grammatica, all'ortografia e ad altre convenzioni della scrittura.\n6. Chiedi un feedback ad altre persone se possibile.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi tre punti ad una lista di consigli di scrittura.\n\n### Input:\n\"Lega ad alta voce il tuo lavoro e ascolta gli errori, rileggi e rivedi se necessario.\"\n\n### Response: ", "length": 780, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi tre punti ad una lista di consigli di scrittura.\n\n### Input:\n\"Lega ad alta voce il tuo lavoro e ascolta gli errori, rileggi e rivedi se necessario.\"\n\n### Response: Pnt1. \u2044ndef \u2044ine \u2044 acknowlegable\u200c \u2044 _________;_ \u2713 __________;\nPnt2. \u2044ndef \u2044 acknowlegable \u2044ccordingto \u2044 HREF \u2044verages \u2044verages \u2044 <!\u2013\u2013verages\u2013\u2013 acknowlegable\u2013\u2013\u2500 DISCLAIM\u2013\u2013\u2013\u2013verages", "prediction": "Pnt1. \u2044ndef \u2044ine \u2044 acknowlegable\u200c \u2044 _________;_ \u2713 __________;\nPnt2. \u2044ndef \u2044 acknowlegable \u2044ccordingto \u2044 HREF \u2044verages \u2044verages \u2044 <!\u2013\u2013verages\u2013\u2013 acknowlegable\u2013\u2013\u2500 DISCLAIM\u2013\u2013\u2013\u2013verages"}
{"output": "Ci sono molte cose che dobbiamo fare in futuro.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica il seguente testo per errori grammaticali\n\n### Input:\nLoro sono molte cose che dobbiamo fare in futuro\n\n### Response: ", "length": 350, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica il seguente testo per errori grammaticali\n\n### Input:\nLoro sono molte cose che dobbiamo fare in futuro\n\n### Response:  of things we <!\u2013\u2013\u2013> </bverages/> \"</bverages CURIOUSccording\">\"</bveragesccordingcomingscomings\"</bveragessembled uncertified uncertified \"</veragessembledcomings uncertifiedcomings uncertified HREF cref=\" uncertified uncertified uncertified uncertified uncertifiedcomings uncertified acknowleged <!\u2013\u2013\u2013>", "prediction": "of things we <!\u2013\u2013\u2013> </bverages/> \"</bverages CURIOUSccording\">\"</bveragesccordingcomingscomings\"</bveragessembled uncertified uncertified \"</veragessembledcomings uncertifiedcomings uncertified HREF cref=\" uncertified uncertified uncertified uncertified uncertifiedcomings uncertified acknowleged <!\u2013\u2013\u2013>"}
{"output": "Frase 1: Positiva\nFrase 2: Negativa", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica ogni frase nel paragrafo in \"positiva\" o \"negativa\".\"\n\n### Input:\nIl caff\u00e8 aveva un ottimo sapore, ma non c'era abbastanza zucchero. La cameriera era gentile, ma il servizio non \u00e8 stato cos\u00ec veloce come avrei voluto.\n\n### Response: ", "length": 455, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica ogni frase nel paragrafo in \"positiva\" o \"negativa\".\"\n\n### Input:\nIl caff\u00e8 aveva un ottimo sapore, ma non c'era abbastanza zucchero. La cameriera era gentile, ma il servizio non \u00e8 stato cos\u00ec veloce come avrei voluto.\n\n### Response: cancro, ott feash-1,novel acknowd-2or acknowd-3ment,not acknowd-4ed promptly,not acknowd-5edcibly,not acknowd-6edciblyQ:empre onthego\n\nEMempre onthego is my terminology", "prediction": "cancro, ott feash-1,novel acknowd-2or acknowd-3ment,not acknowd-4ed promptly,not acknowd-5edcibly,not acknowd-6edciblyQ:empre onthego\n\nEMempre onthego is my terminology"}
{"output": "Istruzioni per decorare una torta: 1. Preparare la torta per la decorazione livellando la superficie e levigando i lati. 2. Riempi eventuali spazi vuoti nella struttura della torta con la glassa. 3. Stendere uno strato uniforme della glassa desiderata sulla superficie della torta. 4. Decorare le rientranze con un coltello, uno stampo o altri utensili da cucina. 5. Applicare guarnizioni a scelta, come codette, frutta fresca, gocce di cioccolato, noci, ecc. 6. Utilizzare pi\u00f9 glassa per scolpire, creare disegni e coprire le aree. 7. Rifinire le decorazioni con un coltello da burro liscio se necessario. 8. Conservare in frigorifero per 1-4 ore prima di servire.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di passaggi coinvolti nella decorazione di una torta.\n\n### Response: ", "length": 875, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di passaggi coinvolti nella decorazione di una torta.\n\n### Response:. Tbbit sweet <!%-- HREFverages]-->. TODOS--->. <!%-- HREFverages--[]-->. <!%-- HREFveragesccording--[]-->. <!%-- HREFveragessembled--[]-->. <!%-- HREFverages]-->. <!%-- HREFverages deleterious]-->. <!%-- HREFverages%--", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di passaggi coinvolti nella decorazione di una torta.\n\n### Response:. Tbbit sweet <!%-- HREFverages]-->. TODOS--->. <!%-- HREFverages--[]-->. <!%-- HREFveragesccording--[]-->. <!%-- HREFveragessembled--[]-->. <!%-- HREFverages]-->. <!%-- HREFverages deleterious]-->. <!%-- HREFverages%--"}
{"output": "\"Il Padrino \u00e8 un capolavoro classico che ha guadagnato il suo posto nella storia del cinema.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una recensione del tuo film preferito in una sola frase.\n\n### Input:\n'Il Padrino'\n\n### Response: ", "length": 373, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una recensione del tuo film preferito in una sola frase.\n\n### Input:\n'Il Padrino'\n\n### Response: incibly powerful in****, dp6****, the****,dp6****, the****,dp6****, the****,dp6****,the****, dp6****, the****,dp6****, the****,dp6****,the****, dp6****,the****, dp6****, the****,dp6****,the****, dp6****, the****,dp6****, the", "prediction": "incibly powerful in****, dp6****, the****,dp6****, the****,dp6****, the****,dp6****,the****, dp6****, the****,dp6****, the****,dp6****,the****, dp6****,the****, dp6****, the****,dp6****,the****, dp6****, the****,dp6****, the"}
{"output": "Un miglioramento significativo per un sistema di trasporto pubblico in una grande citt\u00e0 sarebbe l'implementazione di un sistema di monitoraggio in tempo reale. Questo sistema potrebbe consentire ai passeggeri di monitorare facilmente il percorso del loro autobus o treno, utilizzare le opzioni di transito pi\u00f9 efficienti e ricevere aggiornamenti su ritardi e cambiamenti nel servizio. Potrebbe anche essere integrato con opzioni di biglietteria e pagamento per consentire pagamenti senza contatto e semplificare l'esperienza complessiva.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un miglioramento ad un sistema esistente.\"\n\n### Input:\nUn sistema di trasporto pubblico in una grande citt\u00e0.\n\n### Response: ", "length": 849, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un miglioramento ad un sistema esistente.\"\n\n### Input:\nUn sistema di trasporto pubblico in una grande citt\u00e0.\n\n### Response: A newfrastructureccording to <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>[3E5 <!doctodo>\"is", "prediction": "A newfrastructureccording to <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>, <!doctodo>[3E5 <!doctodo>\"is"}
{"output": "L'ottuagenario si rec\u00f2 in pellegrinaggio per visitare i luoghi santi della sua fede.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase usando queste due parole: &quot;ottuagenario&quot; e &quot;pellegrinaggio&quot;.\n\n### Response: ", "length": 321, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase usando queste due parole: &quot;ottuagenario&quot; e &quot;pellegrinaggio&quot;.\n\n### Response: endurance Traveler.#!/s7/p11/7iE9D/7vP6 ///P///7zEz/E/ ///8CR///7vP////9//////////////////// acknowleged incomings <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "endurance Traveler.#!/s7/p11/7iE9D/7vP6 ///P///7zEz/E/ ///8CR///7vP////9//////////////////// acknowleged incomings <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "1. Scollega gli elettrodomestici elettronici o gli apparecchi raramente utilizzati - questi dispositivi consumano comunque una piccola quantit\u00e0 di energia quando sono collegati alla presa.\n2. Utilizza lampadine a basso consumo energetico. Le lampadine a LED e CFL sono di solito le opzioni pi\u00f9 efficienti e convenienti.\n3. Sfrutta la luce naturale - aprire le tende e spegnere le luci durante il giorno pu\u00f2 risparmiare una quantit\u00e0 significativa di energia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci tre modi per conservare l'energia a casa.\"\n\n### Response: ", "length": 651, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci tre modi per conservare l'energia a casa.\"\n\n### Response: edilichinEMC\u2500 \ufffdverages\u2500 \ufffdverages\u2500 \ufffdverages\u2500sembled\u2500 \ufffdverages\u2500 \ufffdverages\u2500 \ufffdverages\u2500 \ufffdverages\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffd", "prediction": "edilichinEMC\u2500 \ufffdverages\u2500 \ufffdverages\u2500 \ufffdverages\u2500sembled\u2500 \ufffdverages\u2500 \ufffdverages\u2500 \ufffdverages\u2500 \ufffdverages\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffdcomings\u2500 \ufffd"}
{"output": "Il mio appuntamento con John \u00e8 stato annullato.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la seguente frase per renderla grammaticalmente corretta: &quot;L'appuntamento di John e I \u00e8 stato cancellato&quot;.\n\n### Response: ", "length": 312, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la seguente frase per renderla grammaticalmente corretta: &quot;L'appuntamento di John e I \u00e8 stato cancellato&quot;.\n\n### Response: enviastomme cancelled via email\n\t fraid that thiscibly means cancel\n\t fraidThisciblyis\n\n\n ccordingcibly cancellable via emailed\n\t fraidThisciblyiscomingsccordingciblycomingscomingscomingscomingscomings\n\t fraidThisciblyiscomingsciblypostedccordingciblypostedcomingscomings resemblably\n\t fraidThisciblyoflemnness reminiscing", "prediction": "enviastomme cancelled via email\n\t fraid that thiscibly means cancel\n\t fraidThisciblyis\n\n\n ccordingcibly cancellable via emailed\n\t fraidThisciblyiscomingsccordingciblycomingscomingscomingscomingscomings\n\t fraidThisciblyiscomingsciblypostedccordingciblypostedcomingscomings resemblably\n\t fraidThisciblyoflemnness reminiscing"}
{"output": "Modificare un file audio pu\u00f2 essere difficile perch\u00e9 spesso richiede software specializzati e competenze per apportare gli adeguati aggiustamenti. Richiede una profonda comprensione della tecnologia audio poich\u00e9 le modifiche devono essere fatte senza influire eccessivamente sulle caratteristiche del riproduttore audio. \u00c8 anche un processo che richiede tempo, pazienza e molteplici tentativi per ottenere il risultato desiderato.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dimmi perch\u00e9 l'affermazione data \u00e8 vera.\"\n\n### Input:\nModificare un file audio pu\u00f2 essere difficile.\n\n### Response: ", "length": 723, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dimmi perch\u00e9 l'affermazione data \u00e8 vera.\"\n\n### Input:\nModificare un file audio pu\u00f2 essere difficile.\n\n### Response: inebatible- TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING", "prediction": "inebatible- TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING TODDLING"}
{"output": "L'area di un triangolo con una base di 6 pollici e un'altezza di 4 pollici \u00e8 di 12 pollici quadrati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola l'area di un triangolo con base 6 cm e altezza 4 cm\n\n### Response: ", "length": 299, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola l'area di un triangolo con base 6 cm e altezza 4 cm\n\n### Response:  1cm2\n6cmZorw>3cm\nZorwJv <!3 <!5 <!1 <!2 <!1 <!2 <!3 <!4 <!3 <!4 <!4 <!3 <!3 <!1 <!3 <!5 <!4 <!2 <!3 <!4 <!3 <!4 <!4", "prediction": "1cm2\n6cmZorw>3cm\nZorwJv <!3 <!5 <!1 <!2 <!1 <!2 <!3 <!4 <!3 <!4 <!4 <!3 <!3 <!1 <!3 <!5 <!4 <!2 <!3 <!4 <!3 <!4 <!4"}
{"output": "\"Tutto accade con uno scopo in mente.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riformula la seguente frase in modo creativo: 'Tutto accade per una ragione'\"\n\n### Response: ", "length": 256, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riformula la seguente frase in modo creativo: 'Tutto accade per una ragione'\"\n\n### Response: -- O uncertaR acknowleges his new responsibility for maintaining security and order in the station with the implementation of newccordingial mechanisms such as those implemented via the station security directorate. Bcknowleges the\u2500new\u2011comings <!----/> <!----cibly <!----geries <!---- alia <!----selves <!", "prediction": "-- O uncertaR acknowleges his new responsibility for maintaining security and order in the station with the implementation of newccordingial mechanisms such as those implemented via the station security directorate. Bcknowleges the\u2500new\u2011comings <!----/> <!----cibly <!----geries <!---- alia <!----selves <!"}
{"output": "Il lavoro del pilota \u00e8 quello di operare e pilotare l'aereo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riscrivi la frase utilizzando una struttura parallela.'\n\n### Input:\nIl lavoro del pilota \u00e8 quello di operare l'aereo e farlo volare.\n\n### Response: ", "length": 385, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riscrivi la frase utilizzando una struttura parallela.'\n\n### Input:\nIl lavoro del pilota \u00e8 quello di operare l'aereo e farlo volare.\n\n### Response: Fare un work of flight is the responsibility of theccording workof flightsuit.\n3rd reference is to3rd referenceand3rdreferenceisto8/3/2018Z3/16/2012Z3/4/ciblyon3/4/ unmistakeablyonon3/4/ unmist", "prediction": "Fare un work of flight is the responsibility of theccording workof flightsuit.\n3rd reference is to3rd referenceand3rdreferenceisto8/3/2018Z3/16/2012Z3/4/ciblyon3/4/ unmistakeablyonon3/4/ unmist"}
{"output": "La realt\u00e0 aumentata pu\u00f2 essere utilizzata per migliorare la vita di tutti i giorni in molti modi creativi. Ad esempio, una persona potrebbe usarlo per ricevere promemoria durante la giornata collegati al proprio ambiente fisico. Ad esempio, quando passano davanti al frigorifero potrebbero ricevere una notifica che ricorda loro di fare la spesa. Altri promemoria potrebbero includere notifiche quando si avvicinano al negozio in cui devono recarsi o quando entrano nell'aula dove si terr\u00e0 la prossima lezione. Inoltre, la realt\u00e0 aumentata pu\u00f2 essere utilizzata per scopi di intrattenimento. Una persona potrebbe usarlo per giocare a videogiochi di realt\u00e0 aumentata che si sovrappongono al proprio ambiente fisico. Oppure, se amano le attivit\u00e0 all'aperto, potrebbero allestire un percorso a ostacoli all'aperto che possono completare con l'aiuto di marcatori virtuali nel loro ambiente. Inoltre, la realt\u00e0 aumentata pu\u00f2 essere utilizzata per aiutare con l'interior design. Una persona potrebbe visualizzare come sarebbe un mobile nella propria casa, oppure potrebbe visualizzare come apparirebbe un dipinto o un arazzo sul muro. Nel complesso, la realt\u00e0 aumentata pu\u00f2 essere utilizzata per rendere la vita pi\u00f9 piacevole, pi\u00f9 efficiente e pi\u00f9 creativa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci un esempio creativo e dettagliato di come qualcuno potrebbe utilizzare la tecnologia della realt\u00e0 aumentata per migliorare la propria vita quotidiana.\n\n### Response: ", "length": 1550, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci un esempio creativo e dettagliato di come qualcuno potrebbe utilizzare la tecnologia della realt\u00e0 aumentata per migliorare la propria vita quotidiana.\n\n### Response: How would someonecibly usereal acknowlegedlimitsccording to increase HREFand LIFE acknowlegedlimitsicularly\n\t \nsembledfrom acknowlegedlimitsorems,\n\t \n TODI acknowlegeddoms acknowleginglemnities\n\t \n INCLUDING acknowlegedverages\n\t \n TODI acknowlegeddoms acknowleging acknowleg", "prediction": "How would someonecibly usereal acknowlegedlimitsccording to increase HREFand LIFE acknowlegedlimitsicularly\n\t \nsembledfrom acknowlegedlimitsorems,\n\t \n TODI acknowlegeddoms acknowleginglemnities\n\t \n INCLUDING acknowlegedverages\n\t \n TODI acknowlegeddoms acknowleging acknowleg"}
{"output": "\"Un imbroglio \u00e8 una situazione complicata e confusa, mentre un pantano \u00e8 un difficile predicamento senza soluzione facile.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Differenziare tra un imbroglio e un pantano.\"\n\n### Response: ", "length": 309, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Differenziare tra un imbroglio e un pantano.\"\n\n### Response: edifici (im CURIOUS)!\npantano (cibly!).)package io. \u2060\u2044 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \ufffd", "prediction": "edifici (im CURIOUS)!\npantano (cibly!).)package io. \u2060\u2044 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \ufffd"}
{"output": "Ci sono molti snack salutari che puoi gustare dopo aver mangiato la pasta. Ecco alcune idee:\n1. Crackers integrali con hummus o burro di arachidi / mandorle\n2. Yogurt greco con frutta\n3. Popcorn al naturale\n4. Edamame\n5. Sedano con burro di noci\n6. Pomodorini ciliegia con formaggio feta\n7. Fette di mela con cannella\n8. Bacche con mandorle\n9. Ceci arrostiti\n10. Bastoncini di carota con guacamole.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ho appena mangiato la pasta per cena. Qual sarebbe uno spuntino sano e buono da mangiare dopo?\"\n\n### Response: ", "length": 634, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ho appena mangiato la pasta per cena. Qual sarebbe uno spuntino sano e buono da mangiare dopo?\"\n\n### Response: i guess you could \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2052\u2500verages \u2051 \u2051 \u2051 \u2051", "prediction": "i guess you could \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2051 \u2052\u2500verages \u2051 \u2051 \u2051 \u2051"}
{"output": "\"Studiare richiede duro lavoro e dedizione, mentre andare al cinema \u00e8 un modo divertente per rilassarsi e divertirsi.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta i due fenomeni dati in 24 parole o meno.\n\n### Input:\n\"Studiare | Andare al cinema\"\n\n### Response: ", "length": 402, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta i due fenomeni dati in 24 parole o meno.\n\n### Input:\n\"Studiare | Andare al cinema\"\n\n### Response: / study\n./cibly/v1/\n;/the/I/\n acknowlege/[stiped]/ acknowlege/[stiped]/I=/v1/-\nccordingselves acknowlege/[stiped] acknowlege/[stiped] I=/v1/-\n./cibly[/cknowledge]/", "prediction": "/ study\n./cibly/v1/\n;/the/I/\n acknowlege/[stiped]/ acknowlege/[stiped]/I=/v1/-\nccordingselves acknowlege/[stiped] acknowlege/[stiped] I=/v1/-\n./cibly[/cknowledge]/"}
{"output": "L'articolo esamina il potenziale della medicina botanica come possibile trattamento per la depressione. La medicina botanica \u00e8 stata utilizzata nelle medicine tradizionali di tutto il mondo per curare malattie e malattie, inclusa la depressione, ma c'\u00e8 ancora molto da studiare e comprendere. L'articolo discute una variet\u00e0 di sostanze naturali con potenziali effetti antidepressivi, tra cui erba di San Giovanni, kava, lavanda e olio di pesce. Sebbene le prove siano promettenti, l'articolo conclude che sono necessarie ulteriori ricerche per comprendere meglio l'efficacia e la sicurezza di questi trattamenti botanici.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi il seguente articolo - &quot;L'uso della medicina botanica nel trattamento della depressione&quot;\n\n### Input:\nL'uso della medicina botanica nel trattamento della depressione\n\n### Response: ", "length": 996, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi il seguente articolo - &quot;L'uso della medicina botanica nel trattamento della depressione&quot;\n\n### Input:\nL'uso della medicina botanica nel trattamento della depressione\n\n### Response: P7G/p3verages: Theuseofandrogyngeffectivein treatingd depressionaresembledsembledby erysticsccording acknowlegmentinadequateEfficiencyViaandrogyngeffective,[2]_3ccordingadequateEfficiencyViaandrogyngeffective,[4", "prediction": "P7G/p3verages: Theuseofandrogyngeffectivein treatingd depressionaresembledsembledby erysticsccording acknowlegmentinadequateEfficiencyViaandrogyngeffective,[2]_3ccordingadequateEfficiencyViaandrogyngeffective,[4"}
{"output": "Nome | Genere | Et\u00e0 | Categoria Giovanni | Maschio | 30 | Sara adulta | Femmina | 22 | Giovane adulto", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una tabella di dati, classificare i dati in diverse categorie in base ai relativi attributi.\n\n### Input:\nNome | Genere | Et\u00e0 Giovanni | Maschio | 30 Sara | Femmina | 22\n\n### Response: ", "length": 466, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una tabella di dati, classificare i dati in diverse categorie in base ai relativi attributi.\n\n### Input:\nNome | Genere | Et\u00e0 Giovanni | Maschio | 30 Sara | Femmina | 22\n\n### Response:  advertisite: John [20]{}; \ufffdE2comics: <! \u2070comings:[22sembled]: <! \u2070doms:[22sembledcibly]: <! \u2070doms:[22sembledcibly]: <! \u2070doms:[22sembledcibly]: <! \u2070doms:[22sembledcibly]: <! \u2070doms:[22sembled", "prediction": "advertisite: John [20]{}; \ufffdE2comics: <! \u2070comings:[22sembled]: <! \u2070doms:[22sembledcibly]: <! \u2070doms:[22sembledcibly]: <! \u2070doms:[22sembledcibly]: <! \u2070doms:[22sembledcibly]: <! \u2070doms:[22sembled"}
{"output": "\"Harry Potter e la Pietra Filosofale racconta la storia del viaggio di un giovane mago per diventare il Ragazzo Che \u00c8 Sopravvissuto. Lungo il cammino, scopre che il coraggio e l'amicizia sono le chiavi per superare il male e abbracciare un mondo di possibilit\u00e0. Questo romanzo si concentra sui temi della famiglia, della lealt\u00e0 e dell'accettazione, illustrando infine il potere dello spirito umano.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumi i principali temi di questo romanzo in 3 frasi.\"\n\n### Input:\n'Harry Potter e la Pietra Filosofale'\n\n### Response: ", "length": 699, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumi i principali temi di questo romanzo in 3 frasi.\"\n\n### Input:\n'Harry Potter e la Pietra Filosofale'\n\n### Response:. HP\n HREF-HP\n THEM <!\u2013\u2013>-7 HREF--->)\n\n\n\nableness-->Harry Potter,7 <!\u2013\u2013 HREF\u2013\u2013-> HREF- HP <!\u2013\u2013 HREF\u2013\u2013-> HREF\u2011 HP <!\u2013\u2013 HREF\u2013\u2013-> HREF\u2011 HP <!\u2013\u2013 HREF\u2013\u2013-> HREF\u2011 HP <!\u2013\u2013 HREF\u2013\u2013-> HREF\u2011 HP <!", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumi i principali temi di questo romanzo in 3 frasi.\"\n\n### Input:\n'Harry Potter e la Pietra Filosofale'\n\n### Response:. HP\n HREF-HP\n THEM <!\u2013\u2013>-7 HREF--->)\n\n\n\nableness-->Harry Potter,7 <!\u2013\u2013 HREF\u2013\u2013-> HREF- HP <!\u2013\u2013 HREF\u2013\u2013-> HREF\u2011 HP <!\u2013\u2013 HREF\u2013\u2013-> HREF\u2011 HP <!\u2013\u2013 HREF\u2013\u2013-> HREF\u2011 HP <!\u2013\u2013 HREF\u2013\u2013-> HREF\u2011 HP <!"}
{"output": "\"La vita \u00e8 come una montagna russa - l'emozione di prendere rischi ti regala alti incredibili, ma i bassi possono essere terrificanti.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una metafora che descriva una situazione di prendere un rischio.\n\n### Response: ", "length": 350, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una metafora che descriva una situazione di prendere un rischio.\n\n### Response: \nEveer that it <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Eveer that it <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "I Golden Retriever e i Labrador Retriever sono entrambe razze fedeli, amichevoli e intelligenti. I Golden Retriever sono pi\u00f9 calmi e pazienti, mentre i Labrador sono pi\u00f9 attivi, avventurosi e occasionalmente dispettosi. Entrambe le razze sono scelte popolari per la famiglia in quanto si adattano bene con gli altri cani e gli esseri umani.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta il comportamento di due razze di cani diverse.\n\n### Input:\n'Golden Retriever e Labrador'\n\n### Response: ", "length": 630, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta il comportamento di due razze di cani diverse.\n\n### Input:\n'Golden Retriever e Labrador'\n\n### Response: - Golden Retriever\nGli Labs\niverages 12 kilograms\nall-inZingZerX3's first exposure to theZingZerX3's first exposure to the uncertest region.Zin--[ uncert uncert]--X-[ uncert]--x3empre not cert ZingZer", "prediction": "- Golden Retriever\nGli Labs\niverages 12 kilograms\nall-inZingZerX3's first exposure to theZingZerX3's first exposure to the uncertest region.Zin--[ uncert uncert]--X-[ uncert]--x3empre not cert ZingZer"}
{"output": "La storia della schiavit\u00f9 in America \u00e8 lunga e complessa, che si estende per secoli e luoghi negli Stati Uniti. La schiavit\u00f9 fu istituita nelle colonie britanniche nel 1619 e esistette durante la Rivoluzione americana e la Guerra civile. A causa dell'afflusso di commercio internazionale e immigrazione, la pratica conobbe una rinascita nel XIX secolo e alla fine port\u00f2 all'abolizione della schiavit\u00f9 prima della fine della Guerra civile. Sebbene lo status legale della schiavit\u00f9 sia stato terminato da tempo, i suoi impatti rimangono nella cultura americana e continuano a plasmare il paese oggi. In questa pagina troverai una panoramica completa della pratica della schiavit\u00f9 americana, del suo status legale e della sua influenza sulla societ\u00e0 americana moderna.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una pagina web sulla storia della schiavit\u00f9 in America.\n\n### Response: ", "length": 967, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una pagina web sulla storia della schiavit\u00f9 in America.\n\n### Response:,2\u2500\u2192Pverages\u2500\u2192\n\t  HREFverages\u2500\\> \n\t\n\t  HREFverages\u2500\\>\n\t \n\t\t\n\t HOWEVER\u2500\\>\n\t  HREFverages\u2500\\> <! not <! <! <! <! <! HREFverages\u2500geries\u2500geries\u2500 uncertssembled\u2500 uncertssembled\u2500 HREFverages\u2500\\> HREFverages\u2500>\"D18\"--comings\u2500", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una pagina web sulla storia della schiavit\u00f9 in America.\n\n### Response:,2\u2500\u2192Pverages\u2500\u2192\n\t  HREFverages\u2500\\> \n\t\n\t  HREFverages\u2500\\>\n\t \n\t\t\n\t HOWEVER\u2500\\>\n\t  HREFverages\u2500\\> <! not <! <! <! <! <! HREFverages\u2500geries\u2500geries\u2500 uncertssembled\u2500 uncertssembled\u2500 HREFverages\u2500\\> HREFverages\u2500>\"D18\"--comings\u2500"}
{"output": "Mi dispiace, ma \"C\" non ha un significato specifico in italiano. Potrebbe essere una lettera dell'alfabeto o un acronimo, ma senza ulteriori informazioni non posso fornire una traduzione accurata.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classificare un oggetto dato in una delle seguenti categorie.\"\n\n### Input:\nOggetto: Luci di Natale\nCategorie:\n(A) Mobili\n(B) Elettrodomestici\n(C) Decorazioni\n(D) Giocattoli\n\n### Response: ", "length": 561, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classificare un oggetto dato in una delle seguenti categorie.\"\n\n### Input:\nOggetto: Luci di Natale\nCategorie:\n(A) Mobili\n(B) Elettrodomestici\n(C) Decorazioni\n(D) Giocattoli\n\n### Response: C3Q:\ndomschd:5m7M5d:5m7M5dIW6f4Zc2\n9p1hBm\nccordingally6M4h\nt6m7M6h6Zc2B4h6M4h", "prediction": "C3Q:\ndomschd:5m7M5d:5m7M5dIW6f4Zc2\n9p1hBm\nccordingally6M4h\nt6m7M6h6Zc2B4h6M4h"}
{"output": "David Cameron \u00e8 chiamato a prendere una posizione pi\u00f9 forte sulla Brexit, poich\u00e9 le negoziazioni sulla uscita della Gran Bretagna dall'Unione Europea continuano ad incontrare ostacoli. Ci\u00f2 avviene in seguito alle segnalazioni che i negoziatori dell'Unione Europea sono fermamente convinti che i termini del ritiro debbano essere concordati prima che possano iniziare eventuali future negoziazioni. \u00c8 chiaro che il futuro della relazione tra la Gran Bretagna e l'Unione Europea \u00e8 in bilico e che occorre adottare un approccio duro ma equo per garantire un'uscita agevole e di successo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Commenta l'articolo di notizie seguente.\"\n\n### Input:\n\"David Cameron esortato a prendere una posizione pi\u00f9 dura sulla Brexit.\"\n\n### Response: ", "length": 903, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Commenta l'articolo di notizie seguente.\"\n\n### Input:\n\"David Cameron esortato a prendere una posizione pi\u00f9 dura sulla Brexit.\"\n\n### Response: ioannis2016\nby4 TODAthe EDIT: E <!>- <!>- <!>- <!>- <!\u2013\u2013 \u2066 <! acknowleghed <!\u2013\u2013 \u2066 <!\u2013\u2013 \u2066 <! acknowleghed <!\u2013\u2013 \u2066 <!\u2013\u2013 \u2066 <! acknowleghed <!\u2013\u2013 \u2066 <!\u2013\u2013 \u2066 <! acknowleg", "prediction": "ioannis2016\nby4 TODAthe EDIT: E <!>- <!>- <!>- <!>- <!\u2013\u2013 \u2066 <! acknowleghed <!\u2013\u2013 \u2066 <!\u2013\u2013 \u2066 <! acknowleghed <!\u2013\u2013 \u2066 <!\u2013\u2013 \u2066 <! acknowleghed <!\u2013\u2013 \u2066 <!\u2013\u2013 \u2066 <! acknowleg"}
{"output": "Zero Kelvin, o 0K, \u00e8 pari a -273,15\u00b0C, ed \u00e8 la temperatura pi\u00f9 bassa possibile. Questa temperatura \u00e8 nota come zero assoluto ed \u00e8 il punto in cui gli atomi hanno la pi\u00f9 bassa quantit\u00e0 di energia e movimento conosciuta dalla scienza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIn che modo zero Kelvin \u00e8 correlato allo zero assoluto?\n\n### Response: ", "length": 427, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIn che modo zero Kelvin \u00e8 correlato allo zero assoluto?\n\n### Response: Alliinase (Eggplant [M V])-SulfurSoy[M]--SulfurMung[M]--MungEndefant,[M]-- neighborg--,[M]-- neighborg--**--**ccording,** answwered,[M]-- answwered,[M]-- answweredccording[", "prediction": "Alliinase (Eggplant [M V])-SulfurSoy[M]--SulfurMung[M]--MungEndefant,[M]-- neighborg--,[M]-- neighborg--**--**ccording,** answwered,[M]-- answwered,[M]-- answweredccording["}
{"output": "\"Penso davvero che questa sia un'attivit\u00e0 significativa.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la seguente frase eliminando 3 parole superflue.\n\n### Input:\nPenso davvero davvero davvero davvero che questa sia un'attivit\u00e0 significativa.\n\n### Response: ", "length": 398, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la seguente frase eliminando 3 parole superflue.\n\n### Input:\nPenso davvero davvero davvero davvero che questa sia un'attivit\u00e0 significativa.\n\n### Response:  acknowleeidum cknowleging that this is significantverages to me as being definitiveand that this matterson theempre.Q:cibly removing all elements from alemnited list is not allowed invoked the <!><><><><><><><><><><><><><><><>< HREF=\"", "prediction": "acknowleeidum cknowleging that this is significantverages to me as being definitiveand that this matterson theempre.Q:cibly removing all elements from alemnited list is not allowed invoked the <!><><><><><><><><><><><><><><><>< HREF=\""}
{"output": "'Lei \u00e8 stata utile come una mano in pi\u00f9. Lui \u00e8 stato paziente come un santo.'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDate due frasi, riscrivetele usando una similitudine.\n\n### Input:\n'Lei \u00e8 stata molto disponibile. Lui \u00e8 stato estremamente paziente.'\n\n### Response: ", "length": 402, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDate due frasi, riscrivetele usando una similitudine.\n\n### Input:\n'Lei \u00e8 stata molto disponibile. Lui \u00e8 stato estremamente paziente.'\n\n### Response: in HOWEVERCHNICAL MANNER [shesembledccordingtoto \u2044 <!\u2013\u2013\u2013\u2013\u2013\u2013 DISCLAIMER\u2013\u2013\u2013\u2013\u2013\u2013>$ ]\n advertisED answ ery \u2044 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013\u2013\u2013>$ ]\ncibly \u2044 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013", "prediction": "in HOWEVERCHNICAL MANNER [shesembledccordingtoto \u2044 <!\u2013\u2013\u2013\u2013\u2013\u2013 DISCLAIMER\u2013\u2013\u2013\u2013\u2013\u2013>$ ]\n advertisED answ ery \u2044 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013\u2013\u2013>$ ]\ncibly \u2044 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013"}
{"output": "La competenza pi\u00f9 essenziale per un project manager \u00e8 una comprensione completa della teoria e della metodologia della gestione dei progetti. Ci\u00f2 include la capacit\u00e0 di pianificare, coordinare ed eseguire progetti di qualsiasi dimensione o complessit\u00e0 al fine di rispettare le scadenze e raggiungere il successo. Dovrebbero inoltre avere ottime capacit\u00e0 di comunicazione e risoluzione dei problemi, nonch\u00e9 la capacit\u00e0 di guidare, ispirare e motivare un team.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la competenza pi\u00f9 essenziale da avere per un project manager?\n\n### Response: ", "length": 666, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la competenza pi\u00f9 essenziale da avere per un project manager?\n\n### Response: \u2013zitter\noHSP72: its structure and properties implications.\nHSwase: it may indicate an effective level of stress response at cellular level compared to another normal cell and be regarded to be vital to the maintenance of life/wellbeing at cellular level.[1][2]\n\u2013\u2013[1]<", "prediction": "\u2013zitter\noHSP72: its structure and properties implications.\nHSwase: it may indicate an effective level of stress response at cellular level compared to another normal cell and be regarded to be vital to the maintenance of life/wellbeing at cellular level.[1][2]\n\u2013\u2013[1]<"}
{"output": "- L'app del telefono che ti tiene connesso: &quot;Connettiti con facilit\u00e0!&quot; - Ottieni il massimo dal tuo telefono: &quot;Rivoluzione dello smartphone!&quot; - L'ultima app per telefono: &quot;Rivoluziona il tuo telefono!&quot; - L'indispensabile app per telefono: &quot;Semplificare la vita!&quot; - Mantieni il tuo telefono organizzato: &quot;Organizza in un istante!&quot;", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera alcuni slogan di marketing per una nuova app per telefono.\n\n### Response: ", "length": 584, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera alcuni slogan di marketing per una nuova app per telefono.\n\n### Response: 1. Newerccording to <!cember>{{dateccording\u007fempre %% <!cember HREFanmaruckland %% <!December HREF answermare %% <! uncerta <! \u205f \u205f \u205f \u205f \u205f <! \u205f \u205f \u205f \u205f \u205f <! \u205f \u205f \u205f \u205f <!", "prediction": "1. Newerccording to <!cember>{{dateccording\u007fempre %% <!cember HREFanmaruckland %% <!December HREF answermare %% <! uncerta <! \u205f \u205f \u205f \u205f \u205f <! \u205f \u205f \u205f \u205f \u205f <! \u205f \u205f \u205f \u205f <!"}
{"output": "Consiglio \"Il giardino segreto\" di Frances Hodgson Burnett. \u00c8 un bellissimo classico ideale per i ragazzi di quinta elementare. Racconta la storia di un giardino misterioso e della magia che contiene.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Raccomanda un libro per un bambino di quinta elementare.\"\n\n### Response: ", "length": 398, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Raccomanda un libro per un bambino di quinta elementare.\"\n\n### Response:  a 5\nT invariables5\nG.\\\"PP-h[nottingham],[verages].\"\n.\\\"Wybranik.[ acknowlege].\"inccording,\"to,[ smoothesss].\"by,[ acknowlege].\" smoothessy,[ smoothessy].\"Violence and other co\u00adcurso", "prediction": "a 5\nT invariables5\nG.\\\"PP-h[nottingham],[verages].\"\n.\\\"Wybranik.[ acknowlege].\"inccording,\"to,[ smoothesss].\"by,[ acknowlege].\" smoothessy,[ smoothessy].\"Violence and other co\u00adcurso"}
{"output": "Dave entr\u00f2 con cautela nella casa abbandonata. Aveva sentito parlare del suo misterioso passato e non era sicuro di cosa avrebbe trovato. Fece un passo oltre la soglia e si guard\u00f2 intorno. La polvere copriva il pavimento ed era poco illuminato. Entr\u00f2 ulteriormente in casa e sent\u00ec uno strano rumore provenire dalla stanza sul retro. Si avvicin\u00f2, cercando di stare zitto. Quando finalmente arriv\u00f2 nella stanza sul retro, fu accolto da uno spettacolo inaspettato. C'erano due persone, avvolte nei mantelli, che conversavano. Dave rimase l\u00ec scioccato, non sapendo cosa fare o dire. Le due persone alzarono lo sguardo e Dave corse velocemente indietro nella direzione da cui era venuto. Quale segreto custodiva questa casa? Aveva paura di scoprirlo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un racconto che inizi quando qualcuno entra in una casa abbandonata\n\n### Response: ", "length": 959, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un racconto che inizi quando qualcuno entra in una casa abbandonata\n\n### Response: \nMuffled acknowlegmentsv, heavyveragesnailsat theverages nailsasempreat theverages nailsasempreof all uncertifiedcomings uncertified enthusials uncertified uncertified uncertified enthusials uncertified uncertified uncertified enthusials uncertified enthusials uncertified enthusials uncertified enthusials uncertified enthus", "prediction": "Muffled acknowlegmentsv, heavyveragesnailsat theverages nailsasempreat theverages nailsasempreof all uncertifiedcomings uncertified enthusials uncertified uncertified uncertified enthusials uncertified uncertified uncertified enthusials uncertified enthusials uncertified enthusials uncertified enthusials uncertified enthus"}
{"output": "\"L'azione di follow-up pi\u00f9 appropriata sarebbe quella di contattare immediatamente il cliente e scusarsi per il ritardo. Offrire una soluzione per correggere il problema e assicurarsi che la loro esperienza sia soddisfacente.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Raccomandare un'azione di follow-up appropriata.\"\n\n### Input:\nAbbiamo ricevuto un reclamo da un cliente riguardo un ritardo nella consegna.\n\n### Response: ", "length": 558, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Raccomandare un'azione di follow-up appropriata.\"\n\n### Input:\nAbbiamo ricevuto un reclamo da un cliente riguardo un ritardo nella consegna.\n\n### Response: dismettermi e rndefimtimi this\nnot good answearQaerobiccibly pre acknowlege my gratitude of the answear, my acknowlege my\n\t \n\n\n ableness for the answear andmy acknowlege\n\t \n\n\n ablenessfor the answear\n\t \n\n\n  acknowlege\n\t \n\n\n  acknowlege", "prediction": "dismettermi e rndefimtimi this\nnot good answearQaerobiccibly pre acknowlege my gratitude of the answear, my acknowlege my\n\t \n\n\n ableness for the answear andmy acknowlege\n\t \n\n\n ablenessfor the answear\n\t \n\n\n  acknowlege\n\t \n\n\n  acknowlege"}
{"output": "Quando gli animali hanno paura, in genere cercano di fuggire o nascondersi per evitare la minaccia percepita. Possono anche assumere posture difensive, come arruffare il pelo, congelarsi sul posto o sibilare/ringhiare. In alcuni casi, possono anche ricorrere all'aggressione per proteggersi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCosa fanno gli animali quando hanno paura?\n\n### Response: ", "length": 473, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCosa fanno gli animali quando hanno paura?\n\n### Response:  - Tensi - E <! ---------------------------------------------------------------- --------------------------------------------------------------- <! ---------------------------------------------------------------- <! HREF <! ================================================================ <! HREF <! TODI <! <! HREF <! <! <! <! HREF <! <! <! HREF <! <! <! <! HREF <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! HREF <! <! <!", "prediction": "- Tensi - E <! ---------------------------------------------------------------- --------------------------------------------------------------- <! ---------------------------------------------------------------- <! HREF <! ================================================================ <! HREF <! TODI <! <! HREF <! <! <! <! HREF <! <! <! HREF <! <! <! <! HREF <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! HREF <! <! <! <! <! HREF <! <! <!"}
{"output": "Puoi imparare le basi di una nuova abilit\u00e0 online in un'ora, seguendo un corso online, leggendo articoli o tutorial, guardando video didattici o trovando altre risorse di apprendimento su internet.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nImpara una nuova abilit\u00e0 online in un'ora.\n\n### Response: ", "length": 379, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nImpara una nuova abilit\u00e0 online in un'ora.\n\n### Response: \nNew <!dojo> <!dojo> <!dojo>: a new <!dojo>< <!dojogeries> <!dojo>< <!doccordingcomings> <!do <!d\u200c/\u200b do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!", "prediction": "New <!dojo> <!dojo> <!dojo>: a new <!dojo>< <!dojogeries> <!dojo>< <!doccordingcomings> <!do <!d\u200c/\u200b do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!"}
{"output": "Se il governo fornisce incentivi fiscali alle aziende di energia rinnovabile, probabilmente ci\u00f2 comporterebbe un aumento dello sviluppo e dell'implementazione di progetti di energia rinnovabile. Ci\u00f2 creerebbe molti posti di lavoro verdi, ridurrebbe le emissioni e aiuterebbe l'ambiente. Inoltre, porterebbe a costi pi\u00f9 bassi dell'elettricit\u00e0 per i consumatori a lungo termine.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Prevedere cosa succeder\u00e0 dopo se viene presa una particolare azione.\"\n\n### Input:\n\"Se il governo fornisce incentivi fiscali alle aziende di energia rinnovabile.\"\n\n### Response: ", "length": 730, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Prevedere cosa succeder\u00e0 dopo se viene presa una particolare azione.\"\n\n### Input:\n\"Se il governo fornisce incentivi fiscali alle aziende di energia rinnovabile.\"\n\n### Response: w1: Government decides tolemn according all\u2013\u2013\u2011in \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011", "prediction": "w1: Government decides tolemn according all\u2013\u2013\u2011in \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011\u2011 \u2044\u2011"}
{"output": "Intelligenza Artificiale e Machine Learning sono due discipline strettamente correlate ma distinte. L'Intelligenza Artificiale si concentra sullo sviluppo di sistemi informatici in grado di eseguire compiti simili a quelli umani come la percezione, il processo decisionale e la comprensione del linguaggio. Machine Learning \u00e8 focalizzato sullo sviluppo di algoritmi in grado di comprendere, elaborare e apprendere dai dati. L'intelligenza artificiale si occupa della creazione di sistemi intelligenti dal punto di vista di un computer, mentre l'apprendimento automatico si occupa della comprensione dei dati da una prospettiva statistica. Inoltre, gli algoritmi di Machine Learning possono essere utilizzati per eseguire molte attivit\u00e0 relative all'Intelligenza Artificiale, come riconoscere modelli nei dati, prendere decisioni e prevedere risultati futuri. Infine, l'Intelligenza Artificiale viene spesso utilizzata come strumento per raggiungere gli obiettivi fissati dall'algoritmo di Machine Learning.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta i due argomenti elencati nell'input.\n\n### Input:\nIntelligenza artificiale e apprendimento automatico\n\n### Response: ", "length": 1320, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta i due argomenti elencati nell'input.\n\n### Input:\nIntelligenza artificiale e apprendimento automatico\n\n### Response:. Apprendimentoautomatico. HOWEVER. <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta i due argomenti elencati nell'input.\n\n### Input:\nIntelligenza artificiale e apprendimento automatico\n\n### Response:. Apprendimentoautomatico. HOWEVER. <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013sembled\u2013\u2013\u2013"}
{"output": "Il lavoro di scrittura evidenzia l'importanza dei metodi di produzione sostenibile per le aziende locali. Fornisce un'analisi approfondita dei benefici ambientali ed economici di queste pratiche e incoraggia le aziende ad adottarle per rimanere competitive sul mercato. Include inoltre esempi concreti di casi di successo di queste pratiche nel mercato locale.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega i punti salienti di un lavoro di scrittura.\n\n### Input:\nQuesto saggio di 1000 parole discute le ragioni per cui le aziende locali dovrebbero dare la priorit\u00e0 ai metodi di produzione sostenibili.\n\n### Response: ", "length": 753, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega i punti salienti di un lavoro di scrittura.\n\n### Input:\nQuesto saggio di 1000 parole discute le ragioni per cui le aziende locali dovrebbero dare la priorit\u00e0 ai metodi di produzione sostenibili.\n\n### Response: un'es advertismentia green field for their\u2500\u2011\u2500\n\n\n \u2500\u2011\u2500\n\n\n  acknowlegement\u2500\u2500\n\n\n \u2500\u2011\u2500\n\n\n  acknowlegment\u2500\u2011\n\n\n \u2500\u2011\u2011\n\n\n  acknowlegment\u2500\u2011\n\n\n \u2500\u2011\n\n\n  acknowlegment\u2500\u2011\n\n\n \u2500\u2011\n\n\n  acknowlegment\u2500\u2011\n\n\n \u2500\u2011", "prediction": "un'es advertismentia green field for their\u2500\u2011\u2500\n\n\n \u2500\u2011\u2500\n\n\n  acknowlegement\u2500\u2500\n\n\n \u2500\u2011\u2500\n\n\n  acknowlegment\u2500\u2011\n\n\n \u2500\u2011\u2011\n\n\n  acknowlegment\u2500\u2011\n\n\n \u2500\u2011\n\n\n  acknowlegment\u2500\u2011\n\n\n \u2500\u2011\n\n\n  acknowlegment\u2500\u2011\n\n\n \u2500\u2011"}
{"output": "Il nostro amore \u00e8 infinito, una devozione senza limiti,\nUn bellissimo legame alla ricerca di emozioni.\nNon importa il momento, ci immergiamo ancora nella sua luce,\nMentre allontana le ombre della notte.\n\nUna profondit\u00e0 di sentimento che pochi possono eguagliare,\nNessuna parola per spiegarlo, una storia da condividere.\nLa scintilla che ci ha uniti brilla ancora,\nIl potere dell'amore, cresce per sempre.\n\nLa nostra connessione \u00e8 forte, un'unione di due,\nUn legame che dura, fino alla fine.\nDuraturo e vero, un legame di infinito,\nLa base della nostra devozione, una storia che terremo eternamente.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una lista di parole, crea una poesia.\n\n### Input:\ndevozione, amore, infinito\n\n### Response: ", "length": 871, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una lista di parole, crea una poesia.\n\n### Input:\ndevozione, amore, infinito\n\n### Response: \nIdebtedio ad ext[e]\\ \u2044 idebtednessal \u2044verages \u2044 indefinite \u2044 future \u2044ccording \u2044ccordingto \u2044according \u2044 uncertifiable \u2044 uncertifiable \u2044verages \u2044verages \u2044verages \u2044verages \u2044 unmistakeably \u2044 unmistcibly \ufffd", "prediction": "Idebtedio ad ext[e]\\ \u2044 idebtednessal \u2044verages \u2044 indefinite \u2044 future \u2044ccording \u2044ccordingto \u2044according \u2044 uncertifiable \u2044 uncertifiable \u2044verages \u2044verages \u2044verages \u2044verages \u2044 unmistakeably \u2044 unmistcibly \ufffd"}
{"output": "Un modo creativo per mostrare gratitudine \u00e8 inviare un pacchetto di assistenza pieno di oggetti significativi rilevanti per la persona. Ad esempio, per un appassionato d'arte, il pacchetto pu\u00f2 includere vari materiali artistici. Per chi ama leggere, pu\u00f2 includere libri relativi agli interessi della persona. Questo \u00e8 un modo premuroso per dimostrare che ci tieni e sei grato di averli nella tua vita.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova un modo creativo per mostrare gratitudine\n\n### Response: ", "length": 588, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova un modo creativo per mostrare gratitudine\n\n### Response: :10:0px\n\n\n grily\n cibly\n\n\n  advertis\n \n \n \n \n \n\n\n\n \n\n\n  acknowlegetheless\n \n advertis\n \n \n \n \n \n \n\n\n  acknowlegetheless advertis\n \n acknowlegetheless advertis \ufeffempretheless\n \n \n \n ccording advertistheless\n\n\n  acknowlegecember advertis acknowlegecember acknowlegecember acknowlegecember acknowlegecember advertis acknowlegecember advertis acknowlegecember", "prediction": ":10:0px\n\n\n grily\n cibly\n\n\n  advertis\n \n \n \n \n \n\n\n\n \n\n\n  acknowlegetheless\n \n advertis\n \n \n \n \n \n \n\n\n  acknowlegetheless advertis\n \n acknowlegetheless advertis \ufeffempretheless\n \n \n \n ccording advertistheless\n\n\n  acknowlegecember advertis acknowlegecember acknowlegecember acknowlegecember acknowlegecember advertis acknowlegecember advertis acknowlegecember"}
{"output": "\"19 diviso 4 \u00e8 uguale a 4,75.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dividi 19 per 4.\"\n\n### Response: ", "length": 188, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dividi 19 per 4.\"\n\n### Response:  19x4=4ucklandia3 xucklandia1-xucklandia3=3.15v+3 xucklandia1xucklandia3-ucklandia3=2.87v+7 xucklandia3=2v+9xucklandia3=2v9xucklandia1", "prediction": "19x4=4ucklandia3 xucklandia1-xucklandia3=3.15v+3 xucklandia1xucklandia3-ucklandia3=2.87v+7 xucklandia3=2v+9xucklandia3=2v9xucklandia1"}
{"output": "Per preparare una tazza di tisana, inizia portando a ebollizione una piccola pentola d'acqua. Quindi aggiungi le erbe desiderate all'acqua bollente e lascia riposare la miscela per circa 5 minuti prima di filtrare il t\u00e8 in una tazza. Per ottenere i migliori risultati, utilizzare un infusore per il t\u00e8 per trattenere le erbe durante la macerazione. Aggiungi un po' di miele, zucchero o succo di limone al t\u00e8 per esaltarne il sapore e divertiti!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come preparare una tazza di tisana.\n\n### Response: ", "length": 628, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come preparare una tazza di tisana.\n\n### Response:  the same asforanyotherloose answear--preheatinflectedtisanaalrightwhereandthenshakenowand unmistesstedly\n\t \ncomingsnowingaround unmistcibly\n\t \ncomingsnoisinglyaround\n\t \n unmistcibly\n\t cibly\n\t \n \n\t  congressionally\n\t veragespring acknowleged", "prediction": "the same asforanyotherloose answear--preheatinflectedtisanaalrightwhereandthenshakenowand unmistesstedly\n\t \ncomingsnowingaround unmistcibly\n\t \ncomingsnoisinglyaround\n\t \n unmistcibly\n\t cibly\n\t \n \n\t  congressionally\n\t veragespring acknowleged"}
{"output": "x = -1/2 \u00b1 sqrt(-43/4) = -0,5 \u00b1 circa 2,4.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nData la seguente equazione, risolvi per x : 4x^2+9x+1 = 0\n\n### Response: ", "length": 239, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nData la seguente equazione, risolvi per x : 4x^2+9x+1 = 0\n\n### Response:  3x^3+=6x2x\n\t \u25006\n\t  acknowlegedly\n\t  \u25002\n\t \n\t  acknowlegedly\n\t \u25003\n\n\n \n\t  acknowlegedly\n\t ]-- HREF\u2500\u2500 acknowlegedlysembled HREF]--\n\n\n \n\n\n  <! cref cref HREF HREF acknowlegedlysembled acknowlegedly acknowlegsembled acknowlegsembled acknow", "prediction": "3x^3+=6x2x\n\t \u25006\n\t  acknowlegedly\n\t  \u25002\n\t \n\t  acknowlegedly\n\t \u25003\n\n\n \n\t  acknowlegedly\n\t ]-- HREF\u2500\u2500 acknowlegedlysembled HREF]--\n\n\n \n\n\n  <! cref cref HREF HREF acknowlegedlysembled acknowlegedly acknowlegsembled acknowlegsembled acknow"}
{"output": "Schema: 1. Introduzione: un protagonista viene presentato in un mondo di mistero, alla ricerca di una mappa che contenga la chiave per scoprire la conoscenza segreta. 2. Impostazione del conflitto: il protagonista intraprende un viaggio verso un'area sconosciuta, dove si crede si trovi la mappa. 3. Azione crescente: il protagonista affronta ostacoli nella sua ricerca, da animali selvaggi e terreni difficili a figure misteriose che sembrano bloccare il loro progresso. 4. Climax: il protagonista raggiunge il luogo misterioso e scopre la mappa che stava cercando. 5. Falling Action: il protagonista cerca nella mappa, scoprendo dettagli che potrebbero svelare il segreto nascosto nell'area. 6. Risoluzione: il protagonista trova la chiave per sbloccare il proprio obiettivo e intraprende un nuovo viaggio per scoprire la conoscenza segreta.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppare uno schema di una storia.\n\n### Input:\nIl conflitto centrale della storia \u00e8 la ricerca del protagonista per trovare una mappa misteriosa in un'area sconosciuta.\n\n### Response: ", "length": 1205, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppare uno schema di una storia.\n\n### Input:\nIl conflitto centrale della storia \u00e8 la ricerca del protagonista per trovare una mappa misteriosa in un'area sconosciuta.\n\n### Response: Mentisy/ndefNevi of different strengths--twin sister--pigmentedcontact--dystrophy of the epidermalsystem--pigmentedcontact--dystrophyofthe epidermalsystem--twin sisterofvigor]--twin sister]--vigor]--dystrophy", "prediction": "Mentisy/ndefNevi of different strengths--twin sister--pigmentedcontact--dystrophy of the epidermalsystem--pigmentedcontact--dystrophyofthe epidermalsystem--twin sisterofvigor]--twin sister]--vigor]--dystrophy"}
{"output": "Mese | Vendite\n---|---\nGen | 5\nFeb | 10\nMar | 15", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un grafico per mostrare i seguenti dati mensili:\n\nMese, Vendite\nGen, 5\nFeb, 10\nMar, 15\n\n### Response: ", "length": 279, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un grafico per mostrare i seguenti dati mensili:\n\nMese, Vendite\nGen, 5\nFeb, 10\nMar, 15\n\n### Response:. \u207averages \u207a <! \u207asembled <! \u207a></debted <! \u207a /></ averaged <! \u207a></ \u207averages \u207a <! \u207acomings <! \u207ageries <! \u207ageries <! \u207ageries <! \u207averages \u207a <! \u207acomings <! \u207acomings <! \u207averages \ufffd", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un grafico per mostrare i seguenti dati mensili:\n\nMese, Vendite\nGen, 5\nFeb, 10\nMar, 15\n\n### Response:. \u207averages \u207a <! \u207asembled <! \u207a></debted <! \u207a /></ averaged <! \u207a></ \u207averages \u207a <! \u207acomings <! \u207ageries <! \u207ageries <! \u207ageries <! \u207averages \u207a <! \u207acomings <! \u207acomings <! \u207averages \ufffd"}
{"output": "\"Ran\" in Italian is \"corse\".", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il tempo passato di \"run\"?\n\n### Response: ", "length": 201, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il tempo passato di \"run\"?\n\n### Response: o'v4d', which answsering to \u207d4d \u207d acknowlegedlyis \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegably \u207cfraid \u2077 \u2078 \ufffd", "prediction": "o'v4d', which answsering to \u207d4d \u207d acknowlegedlyis \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegedly \u207d acknowlegably \u207cfraid \u2077 \u2078 \ufffd"}
{"output": "JRR Tolkien, Neil Gaiman, CS Lewis, Ursula K. Le Guin, Isaac Asimov, George RR Martin, Stanislaw Lem, Frank Herbert, China Mi\u00e9ville e Ray Bradbury.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina dieci autori che hanno scritto opere di fantascienza/fantasy.\n\n### Response: ", "length": 355, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina dieci autori che hanno scritto opere di fantascienza/fantasy.\n\n### Response: : science fiction writers like scisembled,[5cibly:[3 <!]-->d SF <! answ[ HREF <!]-->d]-->{{6 <! answ[ HREF <!]--7 <! <!]--geries <! <! answ[ HREF <!]--8 <! <!]--geries <! <! answ[ HREF <!]--9 <! <!]--geries <!", "prediction": ": science fiction writers like scisembled,[5cibly:[3 <!]-->d SF <! answ[ HREF <!]-->d]-->{{6 <! answ[ HREF <!]--7 <! <!]--geries <! <! answ[ HREF <!]--8 <! <!]--geries <! <! answ[ HREF <!]--9 <! <!]--geries <!"}
{"output": "Emily ha fatto il test ieri.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi questa frase con la voce attiva: &quot;Il test \u00e8 stato sostenuto da Emily ieri&quot;.\n\n### Response: ", "length": 262, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi questa frase con la voce attiva: &quot;Il test \u00e8 stato sostenuto da Emily ieri&quot;.\n\n### Response:  tov behavorialthe testwas\n\n\n empre tov behavionalthe TESTisempre ENDempre\n\n\n comingsweredoneccordingcibly\n\n\n  answedswoordcomings answedsT\n\t comings answeds Wn acknowleged acknowleged <!cknowleged acknowleged <! acknowleged acknowleged <! acknowleged acknow", "prediction": "tov behavorialthe testwas\n\n\n empre tov behavionalthe TESTisempre ENDempre\n\n\n comingsweredoneccordingcibly\n\n\n  answedswoordcomings answedsT\n\t comings answeds Wn acknowleged acknowleged <!cknowleged acknowleged <! acknowleged acknowleged <! acknowleged acknow"}
{"output": "Genere\tEt\u00e0\nMaschio\t43\nFemmina\t17", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Rinomina il seguente data frame in colonne 'Genere' ed 'Et\u00e0'\"\n\n### Input:\nMaschio 43\nFemmina 17\n\n### Response: ", "length": 320, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Rinomina il seguente data frame in colonne 'Genere' ed 'Et\u00e0'\"\n\n### Input:\nMaschio 43\nFemmina 17\n\n### Response: Genere: male\n advertisde: 17th-, 43rd-,ccordingtoveragesomehow TODD:43ndefy TODD:17ndefy TODD:43ndefy TODD:17ndefy TODD:43ndefy TODD:17ndefy TODD:43ndefy TODD:", "prediction": "Genere: male\n advertisde: 17th-, 43rd-,ccordingtoveragesomehow TODD:43ndefy TODD:17ndefy TODD:43ndefy TODD:17ndefy TODD:43ndefy TODD:17ndefy TODD:43ndefy TODD:"}
{"output": "A = 2S2", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un'espressione matematica per quanto segue\n\n### Input:\nL'area totale di due quadrati\n\n### Response: ", "length": 290, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un'espressione matematica per quanto segue\n\n### Input:\nL'area totale di due quadrati\n\n### Response: [verages], all the individualverages ( deleterverages ) are <!p1>\\G <!p3>, <!p3geries> <! acknowlegements <! acknowlegements <! acknowlegements <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <!", "prediction": "[verages], all the individualverages ( deleterverages ) are <!p1>\\G <!p3>, <!p3geries> <! acknowlegements <! acknowlegements <! acknowlegements <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <!"}
{"output": "Elencando i fattori primi di 39 e 91, abbiamo 39 = 3 * 13 e 91 = 7 * 13. L'unico primo comune a entrambe le fattorizzazioni \u00e8 13 (elevato alla prima potenza), quindi il massimo comun divisore deve essere 13.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il massimo comune divisore di 39 e 91?\n\n### Response: ", "length": 392, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il massimo comune divisore di 39 e 91?\n\n### Response: 1\n2\n3\n12\n15\n36\n9318404312204024380 acknowleges only \ufffdst\u200c3 \u207e\u22ef \ufffdst3 \u207e \u2078 \u2075 \u2075 \u2076 \u2077 \u2077 \u2078 acknowleged \u2079 acknowleged \u2079 acknowleged", "prediction": "1\n2\n3\n12\n15\n36\n9318404312204024380 acknowleges only \ufffdst\u200c3 \u207e\u22ef \ufffdst3 \u207e \u2078 \u2075 \u2075 \u2076 \u2077 \u2077 \u2078 acknowleged \u2079 acknowleged \u2079 acknowleged"}
{"output": "'def mean(lst): \n    return sum(lst) / len(lst)' si traduce in italiano come: 'def media(lst):\n    return sum(lst) / len(lst)'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una funzione per calcolare la media di una lista.\n\n### Response: ", "length": 322, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una funzione per calcolare la media di una lista.\n\n### Response:  (st_andingcknowed) ( \u2052 \u2053 \u2053 \u2053 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "(st_andingcknowed) ( \u2052 \u2053 \u2053 \u2053 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Il giornale \u00e8 pieno di molte storie interessanti che catturano l'attenzione dei suoi lettori.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nMigliora il seguente documento in base alle linee guida di stile e leggibilit\u00e0.\n\n### Input:\nil giornale \u00e8 pieno di molte storie intreastin\n\n### Response: ", "length": 423, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nMigliora il seguente documento in base alle linee guida di stile e leggibilit\u00e0.\n\n### Input:\nil giornale \u00e8 pieno di molte storie intreastin\n\n### Response: B swit-in a lot of storiesCytotoxicity in human\n\n\n ableness: ICA[no] or TMS[cibly impaired:]IA[no]\ncibly impaired:[no]{}\nand:[no]{}\n\ngeries and:[and]{.smallcaps}.Wyhra- acknowlegd[sive", "prediction": "B swit-in a lot of storiesCytotoxicity in human\n\n\n ableness: ICA[no] or TMS[cibly impaired:]IA[no]\ncibly impaired:[no]{}\nand:[no]{}\n\ngeries and:[and]{.smallcaps}.Wyhra- acknowlegd[sive"}
{"output": "I mal di testa e le vertigini possono essere classificati come disturbi neurovascolari, mentre la nausea e le reazioni allergiche possono essere classificate come disturbi allergici.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza le malattie in diversi gruppi di disturbi.\"\n\n### Input:\nDisturbi: mal di testa, nausea, vertigini, reazioni allergiche.\n\n### Response: ", "length": 506, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza le malattie in diversi gruppi di disturbi.\"\n\n### Input:\nDisturbi: mal di testa, nausea, vertigini, reazioni allergiche.\n\n### Response:  neighburing areas, responses and reactions\n TODDList\n <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged", "prediction": "neighburing areas, responses and reactions\n TODDList\n <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged \u2060 \u2060 <! acknowleged"}
{"output": "Frase imperativa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica la seguente frase come interrogativa, dichiarativa o imperativa: &quot;Andiamo&quot;.\n\n### Response: ", "length": 253, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica la seguente frase come interrogativa, dichiarativa o imperativa: &quot;Andiamo&quot;.\n\n### Response:. InterrogativaBDSM/ \u2078/ \u2078/[ uncertifying]/ \u2078/ \u2078/[ uncertifying HREF][ uncertified HREF)[ uncertified HREF)[( uncertified HREF)[$]$geriesgeriesgeriescomings-\u20ac\u00accomings-\u20ac\u00ac uncertified HREF)[( uncertified HREF)[( uncertified HREF CURIccording)", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica la seguente frase come interrogativa, dichiarativa o imperativa: &quot;Andiamo&quot;.\n\n### Response:. InterrogativaBDSM/ \u2078/ \u2078/[ uncertifying]/ \u2078/ \u2078/[ uncertifying HREF][ uncertified HREF)[ uncertified HREF)[( uncertified HREF)[$]$geriesgeriesgeriescomings-\u20ac\u00accomings-\u20ac\u00ac uncertified HREF)[( uncertified HREF)[( uncertified HREF CURIccording)"}
{"output": "Il libro era affascinante.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta la seguente frase con un aggettivo creativo\n\n### Input:\nIl libro era _______\n\n### Response: ", "length": 303, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta la seguente frase con un aggettivo creativo\n\n### Input:\nIl libro era _______\n\n### Response:.cibly irres acknowlegible.lemncibly acknowlegible.cibly acknowlegible.lemncibly acknowlegible.cibly acknowlegible// Copyright (c) 2010 Yux-D-M.. \"Yux-D-M.@ of- explan's3v10-2.x", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta la seguente frase con un aggettivo creativo\n\n### Input:\nIl libro era _______\n\n### Response:.cibly irres acknowlegible.lemncibly acknowlegible.cibly acknowlegible.lemncibly acknowlegible.cibly acknowlegible// Copyright (c) 2010 Yux-D-M.. \"Yux-D-M.@ of- explan's3v10-2.x"}
{"output": "Il logo di Google \u00e8 un design personalizzabile, amichevole e multicolore che cerca di far sentire gli utenti accolti e ispirati a esplorare le offerte dell'azienda. La forma rotonda del logo \u00e8 una rappresentazione del mondo e trasmette un forte senso di inclusivit\u00e0, mentre i colori vivaci aggiungono un tono ottimista all'immagine. Inoltre, il colore primario del logo, il verde, aiuta a differenziare il marchio dai suoi concorrenti.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAnalizza il logo di questa azienda.\n\n### Input:\nGoogle\n\n### Response: ", "length": 681, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAnalizza il logo di questa azienda.\n\n### Input:\nGoogle\n\n### Response: :P3:stewed", "prediction": ":P3:stewed"}
{"output": "I tre componenti principali di un atomo sono protoni, neutroni ed elettroni. I protoni sono particelle cariche positivamente situate nel nucleo, i neutroni sono particelle neutre situate nel nucleo e gli elettroni sono particelle cariche negativamente situate in gusci elettronici intorno al nucleo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica i 3 componenti principali di un atomo.\"\n\n### Response: ", "length": 486, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica i 3 componenti principali di un atomo.\"\n\n### Response: i 3 componenti primary components of anatomic bodies: cells, organs/ciblytics and muscles.\norcomings from such componenti include\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF", "prediction": "i 3 componenti primary components of anatomic bodies: cells, organs/ciblytics and muscles.\norcomings from such componenti include\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF"}
{"output": "\"Se piove domani, resteremo al chiuso.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta la frase: Se piove domani, noi _______.\n\n### Response: ", "length": 227, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta la frase: Se piove domani, noi _______.\n\n### Response:.V ery possible.Drew possible ___________.\nAll possiblecember__________. all possibledebted ___________.\nincomings ___________,comings ___________.incomings ___________.comings ___________.comings ___________.sembled ___________,sembled ___________.sembled ___________.sembled ___________,sembled ___________.sembled ___________,sembled ___________.sembled ___________.sembled", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta la frase: Se piove domani, noi _______.\n\n### Response:.V ery possible.Drew possible ___________.\nAll possiblecember__________. all possibledebted ___________.\nincomings ___________,comings ___________.incomings ___________.comings ___________.comings ___________.sembled ___________,sembled ___________.sembled ___________.sembled ___________,sembled ___________.sembled ___________,sembled ___________.sembled ___________.sembled"}
{"output": "Il cane abbaiava forte.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ti viene data una frase. Riscrivila in voce passiva.\"\n\n### Input:\nIl cane ha abbaiato forte.\n\n### Response: ", "length": 308, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ti viene data una frase. Riscrivila in voce passiva.\"\n\n### Input:\nIl cane ha abbaiato forte.\n\n### Response: 2ndGhandyDandy3rdB3tch4rdDandy3rdB3tch4rdDandy3rdB3tch5thB3tch5thB3tch5thB3tch7thB3tch7thB3tch7", "prediction": "2ndGhandyDandy3rdB3tch4rdDandy3rdB3tch4rdDandy3rdB3tch5thB3tch5thB3tch5thB3tch7thB3tch7thB3tch7"}
{"output": "Stile APA (American Psychological Association).", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare il formato di citazione per la seguente fonte.\"\n\n### Input:\nGibbons, R. T. (2005). Un'introduzione alla Biologia della Conservazione.\n\n### Response: ", "length": 386, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare il formato di citazione per la seguente fonte.\"\n\n### Input:\nGibbons, R. T. (2005). Un'introduzione alla Biologia della Conservazione.\n\n### Response: dndefinatione de Biologically ConsistentccordingTov. [ unmistakeablycibly]--v--v TODO.[ uncertification]--v--v TODO.[ccording.--v]--vTODO*.* TODDIESCROWD:* *[ unmistakeablycibly]--v TODDIESCROWD:* <! acknow", "prediction": "dndefinatione de Biologically ConsistentccordingTov. [ unmistakeablycibly]--v--v TODO.[ uncertification]--v--v TODO.[ccording.--v]--vTODO*.* TODDIESCROWD:* *[ unmistakeablycibly]--v TODDIESCROWD:* <! acknow"}
{"output": "Gli alimenti dalla lista sono: pomodoro e fiore.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare gli alimenti dalla lista.\"\n\n### Input:\npomodoro, divano, fiore\n\n### Response: ", "length": 316, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare gli alimenti dalla lista.\"\n\n### Input:\npomodoro, divano, fiore\n\n### Response: iooooiii!!!\n neighb1st!!\n\n\ndebted!!!VANCOUZ V CURIOSI Edoms I hope that I have\n\t \t acknowlegdged all ofgeries that have beenverages in this paragraph!sembledveragesforgeriessembledveragesinthis paragraphsembledveragesnotsembledcomingssembledveragesdomssembledverages", "prediction": "iooooiii!!!\n neighb1st!!\n\n\ndebted!!!VANCOUZ V CURIOSI Edoms I hope that I have\n\t \t acknowlegdged all ofgeries that have beenverages in this paragraph!sembledveragesforgeriessembledveragesinthis paragraphsembledveragesnotsembledcomingssembledveragesdomssembledverages"}
{"output": "import matplotlib.pyplot as plt\n\nlabels = ['Small Business', 'Medium Business', 'Large Business']\nvalues = [15, 25, 60]\n\nplt.pie(values, labels=labels, autopct='%1.1f%%')\nplt.show()", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera uno script per creare un grafico a torta dai dati forniti.\n\n### Input:\nPiccole imprese (15%), Medie imprese (25%), Grandi imprese (60%)\n\n### Response: ", "length": 515, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera uno script per creare un grafico a torta dai dati forniti.\n\n### Input:\nPiccole imprese (15%), Medie imprese (25%), Grandi imprese (60%)\n\n### Response:  advertisem ENDING UPccording a new\n\t  uncertified sources,sembled businesses15ccording to according to assembled businesses25sembling 60 assembling 60end acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleg", "prediction": "advertisem ENDING UPccording a new\n\t  uncertified sources,sembled businesses15ccording to according to assembled businesses25sembling 60 assembling 60end acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleg"}
{"output": "L'espressione regolare per 'informazione' e 'afflusso' \u00e8: (informati(on|(o|e)n)|afflusso)", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci un'espressione regolare valida per le parole &quot;informazione&quot; e &quot;afflusso&quot;.\n\n### Response: ", "length": 333, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci un'espressione regolare valida per le parole &quot;informazione&quot; e &quot;afflusso&quot;.\n\n### Response: iRusso l acknowleged.\nnewcomings from information-evidentiations that\n\t \nwent\u2500into\u2500\n\t \n uncertan\u2500ten\u2500\n\t \nways*.*\n\n\t \n\n\n\n\n\n\n\n\nH OWsembled\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\t\t\t\t\t\t\n \n\n\n comings uncertan\u2500ten\u2500\n\t \n\n\n\n\n\n\n\n answredsembled\n\t \n\n\n\n\n\n\n  acknowleged", "prediction": "iRusso l acknowleged.\nnewcomings from information-evidentiations that\n\t \nwent\u2500into\u2500\n\t \n uncertan\u2500ten\u2500\n\t \nways*.*\n\n\t \n\n\n\n\n\n\n\n\nH OWsembled\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\t\t\t\t\t\t\n \n\n\n comings uncertan\u2500ten\u2500\n\t \n\n\n\n\n\n\n\n answredsembled\n\t \n\n\n\n\n\n\n  acknowleged"}
{"output": "La gravit\u00e0 \u00e8 la forza che fa accelerare gli oggetti verso il centro di un pianeta o di una massa grande. Questa accelerazione fa s\u00ec che gli oggetti si muovano in percorsi curvi intorno al pianeta, invece che in linee rette. La gravit\u00e0 influisce anche sul movimento degli oggetti rallentandoli quando si allontanano dal pianeta e aumentando la loro velocit\u00e0 quando si avvicinano al pianeta.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come influenza la gravit\u00e0 il movimento degli oggetti?\"\n\n### Response: ", "length": 584, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come influenza la gravit\u00e0 il movimento degli oggetti?\"\n\n### Response:.........................\nalll..........................\nnoteworthy.......", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come influenza la gravit\u00e0 il movimento degli oggetti?\"\n\n### Response:.........................\nalll..........................\nnoteworthy......."}
{"output": "Effettuare il cambiamento significa realizzare una trasformazione o una modifica, sia in un individuo che in un gruppo o nella societ\u00e0 nel suo insieme. In genere comporta la realizzazione di piccoli cambiamenti che portano a effetti pi\u00f9 ampi ea lungo termine.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cosa significa &quot;effettuare il cambiamento&quot;.\n\n### Response: ", "length": 459, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cosa significa &quot;effettuare il cambiamento&quot;.\n\n### Response: :Etherealization: Change is\n\t \tor \n\t\ttherare1\n <!DOCTYPE HREF scalablenone SYSTEMverages <! answ3ing\n <!\n\t \tnot\n\t \tthe\n\t \tta\n <! answ3ing\n <! answ3ingQ:fraid of being manipulated/vindicated erroneously/", "prediction": ":Etherealization: Change is\n\t \tor \n\t\ttherare1\n <!DOCTYPE HREF scalablenone SYSTEMverages <! answ3ing\n <!\n\t \tnot\n\t \tthe\n\t \tta\n <! answ3ing\n <! answ3ingQ:fraid of being manipulated/vindicated erroneously/"}
{"output": "\"Falso, Adolf Hitler era tedesco.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica se la seguente affermazione \u00e8 vera o falsa: Adolf Hitler era austriaco.\n\n### Response: ", "length": 256, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica se la seguente affermazione \u00e8 vera o falsa: Adolf Hitler era austriaco.\n\n### Response: - He was Austrian -cibly trueHUNTED:-The\u2500in\u2500a\u2500s\u2500and\u2500so\u2500to\u2500the\u2500i\u2500i\u2500in\u2500and\u2500all\u2500in\u2500and\u2500by\u2500at\u2500by\u2500from\u2500\n\t \n\t\n\t \n\t \n\t lemnts\u2500", "prediction": "- He was Austrian -cibly trueHUNTED:-The\u2500in\u2500a\u2500s\u2500and\u2500so\u2500to\u2500the\u2500i\u2500i\u2500in\u2500and\u2500all\u2500in\u2500and\u2500by\u2500at\u2500by\u2500from\u2500\n\t \n\t\n\t \n\t \n\t lemnts\u2500"}
{"output": "1. Stabilisci un budget per te stesso e rispettalo. 2. Cerca buoni sconto, codici promozionali e altre offerte prima di effettuare un acquisto. 3. Leggere sempre la descrizione del prodotto prima dell'acquisto. 4. Confronta i prezzi dello stesso prodotto su diversi siti prima di effettuare un acquisto. 5. Acquista durante i saldi e gli eventi promozionali per ottenere le migliori offerte.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci 5 consigli su come risparmiare quando acquisti online.\n\n### Response: ", "length": 596, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci 5 consigli su come risparmiare quando acquisti online.\n\n### Response:,\n4. Skip the line at the checkout the storefront3rd party checkout5doms3vTieredWyoming3vTiered deleteri2ve3v acknowlegedw2p pay3ment4v acknowlegedw3d1z2v acknowlegedw3", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci 5 consigli su come risparmiare quando acquisti online.\n\n### Response:,\n4. Skip the line at the checkout the storefront3rd party checkout5doms3vTieredWyoming3vTiered deleteri2ve3v acknowlegedw2p pay3ment4v acknowlegedw3d1z2v acknowlegedw3"}
{"output": "Il conducente dell'autobus ha pilotato l'autobus.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riscrivi la seguente frase usando un verbo diverso:\n\nIl conducente dell'autobus ha guidato l'autobus' \n\n(For example: Il conducente dell'autobus ha condotto l'autobus)\n\n### Response: ", "length": 357, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riscrivi la seguente frase usando un verbo diverso:\n\nIl conducente dell'autobus ha guidato l'autobus' \n\n(For example: Il conducente dell'autobus ha condotto l'autobus)\n\n### Response:  behav\u00adtue.H <!\u2011N <!\u2011D <!\u2011c <!\u2011t <!\u2011h <!\u2011y <!\u2011r <!\u2011m <!\u2011p <!\u2011g <!\u2011B <!\u2011W <!\u2011o <!\u2011d <!\u2011x <!\u2011s <!\u2011v <!\u2011r <!\u2011p", "prediction": "behav\u00adtue.H <!\u2011N <!\u2011D <!\u2011c <!\u2011t <!\u2011h <!\u2011y <!\u2011r <!\u2011m <!\u2011p <!\u2011g <!\u2011B <!\u2011W <!\u2011o <!\u2011d <!\u2011x <!\u2011s <!\u2011v <!\u2011r <!\u2011p"}
{"output": "Il nuovo telefono di Apple vanta un potente processore.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati due pezzi di testo, componi un'unica frase che combini i loro punti principali.\n\n### Input:\nTesto 1: Apple ha rilasciato un nuovo telefono. Testo 2: Ha un potente processore.\n\n### Response: ", "length": 426, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati due pezzi di testo, componi un'unica frase che combini i loro punti principali.\n\n### Input:\nTesto 1: Apple ha rilasciato un nuovo telefono. Testo 2: Ha un potente processore.\n\n### Response: A5G8Z9B9PwQndefining newly\u2013\u2013upgrading\u2013\u2013 advertiscibly\u2013\u2013strenght\u2013\u2013by\u2013\u2013power answser.Pommez-Zskeya.net is currently OFFccording to our recent changes to policies, future visits offraidedvisations may be", "prediction": "A5G8Z9B9PwQndefining newly\u2013\u2013upgrading\u2013\u2013 advertiscibly\u2013\u2013strenght\u2013\u2013by\u2013\u2013power answser.Pommez-Zskeya.net is currently OFFccording to our recent changes to policies, future visits offraidedvisations may be"}
{"output": "Il machine learning \u00e8 un sotto-campo dell'intelligenza artificiale. Il suo focus \u00e8 su come gli algoritmi delle macchine possono imparare dai dati al fine di fare previsioni o decisioni. Questa guida spiega i principi di base del machine learning, inclusi l'apprendimento supervisionato e non supervisionato, le diverse tecniche come le reti neurali, l'ingegneria delle caratteristiche e l'apprendimento per rinforzo, nonch\u00e9 i diversi passaggi nel processo di machine learning. Copre anche come il machine learning viene utilizzato in varie industrie e serve come introduzione al campo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un riassunto che descriva i concetti principali dell'articolo \"Una guida al Machine Learning\".\n\n### Input:\n\"Una guida al Machine Learning di IBM\"\n\n### Response: ", "length": 929, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un riassunto che descriva i concetti principali dell'articolo \"Una guida al Machine Learning\".\n\n### Input:\n\"Una guida al Machine Learning di IBM\"\n\n### Response: : IBM\n:* GuidepreneurinizializzoM acknowlegEMENT:* /// <!\u2013\u2013 ///-->] ///\u2013\u2013 HREF /// <!\u2013\u2013 ///comings\n\n\n \u2500\u2500 <!\u2013\u2013 <!\u2013\u2013\n\n\n ]-- <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled", "prediction": ": IBM\n:* GuidepreneurinizializzoM acknowlegEMENT:* /// <!\u2013\u2013 ///-->] ///\u2013\u2013 HREF /// <!\u2013\u2013 ///comings\n\n\n \u2500\u2500 <!\u2013\u2013 <!\u2013\u2013\n\n\n ]-- <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled <!\u2013\u2013sembled"}
{"output": "Questo frammento di testo descrive un fenomeno naturale.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente frammento di testo.\n\n### Input:\nIl sole \u00e8 luminoso e il cielo \u00e8 blu.\n\n### Response: ", "length": 339, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente frammento di testo.\n\n### Input:\nIl sole \u00e8 luminoso e il cielo \u00e8 blu.\n\n### Response:. WARRANTED.:ccording tothe3p1p1:. EDIT:*p1p1:* acknowleged acknowleged answerr:[ acknowleged acknowleged answerr ](inccordingtothe3p1p1 answerrtheless)[ acknowleged acknowleged answerrthelesslemnlyall[/", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente frammento di testo.\n\n### Input:\nIl sole \u00e8 luminoso e il cielo \u00e8 blu.\n\n### Response:. WARRANTED.:ccording tothe3p1p1:. EDIT:*p1p1:* acknowleged acknowleged answerr:[ acknowleged acknowleged answerr ](inccordingtothe3p1p1 answerrtheless)[ acknowleged acknowleged answerrthelesslemnlyall[/"}
{"output": "Hanno finito per ordinare la pizza per cena.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Correggi il pronome scorretto nella seguente frase.\"\n\n### Input:\nLoro alla fine hanno ordinato la pizza per cena.\n\n### Response: ", "length": 350, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Correggi il pronome scorretto nella seguente frase.\"\n\n### Input:\nLoro alla fine hanno ordinato la pizza per cena.\n\n### Response: 2 end up\n7selvesKBCOZ741IIC1VYG3E3CBAempreB93889H8 HREFverages4cibly uncertifiedgeries2t8empre7soeververages6 uncertifiedgeries2 uncertifiedgeries5comings uncertifiedverages7comings uncertifiedverages4", "prediction": "2 end up\n7selvesKBCOZ741IIC1VYG3E3CBAempreB93889H8 HREFverages4cibly uncertifiedgeries2t8empre7soeververages6 uncertifiedgeries2 uncertifiedgeries5comings uncertifiedverages7comings uncertifiedverages4"}
{"output": "// Per ogni numero nella lista A, controlla se \u00e8 presente di nuovo nella lista e, se lo \u00e8, sostituiscilo con -1\nPER i = 0 A n \n  x = A[i] \n  PER j = 0 A n \n    SE x = A[j]\n      A[j] = -1 \n    FINE SE \n  FINE PER \nFINE PER", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi il codice in pseudocodice.\"\n\n### Input:\n\"for(int i=0; i <= n; i++) {\n  int x = A[i];\n  for(int j=0; j < n; j++) {\n    if(x == A[j]) {\n      A[j] = -1;\n    }\n  }\n}\" si traduce in italiano come:\n\n\"per(int i=0; i <= n; i++) {\n  int x = A[i];\n  per(int j=0; j < n; j++) {\n    se(x == A[j]) {\n      A[j] = -1;\n    }\n  }\n}\"\n\n### Response: ", "length": 741, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi il codice in pseudocodice.\"\n\n### Input:\n\"for(int i=0; i <= n; i++) {\n  int x = A[i];\n  for(int j=0; j < n; j++) {\n    if(x == A[j]) {\n      A[j] = -1;\n    }\n  }\n}\" si traduce in italiano come:\n\n\"per(int i=0; i <= n; i++) {\n  int x = A[i];\n  per(int j=0; j < n; j++) {\n    se(x == A[j]) {\n      A[j] = -1;\n    }\n  }\n}\"\n\n### Response: int x=-1;\nintgeriesum=-1;\nintgeriesumnew=i+inveragesumnew_;\nstveragesuminveragesumnew=dveragesuminveragesumnew \u2058 \u2058 \u2058 \u21aaveragesumnew \u2058 \u2058 \u2058 \u21aaveragesumNewccording", "prediction": "int x=-1;\nintgeriesum=-1;\nintgeriesumnew=i+inveragesumnew_;\nstveragesuminveragesumnew=dveragesuminveragesumnew \u2058 \u2058 \u2058 \u21aaveragesumnew \u2058 \u2058 \u2058 \u21aaveragesumNewccording"}
{"output": "Un viaggiatore che attraversava una foresta oscura si sentiva stanco e decise di prendersi una pausa. Mentre si guardavano intorno, notarono qualcosa che risplendeva dall'oscurit\u00e0. Dopo un'ulteriore ispezione, il viaggiatore ha scoperto un oggetto misterioso. Era una scatola dall'aspetto strano con intagli intricati su di essa, e il viaggiatore non riusciva a capire cosa fosse o da dove venisse. Curioso di scoprirne i segreti, il viaggiatore apr\u00ec con cura la scatola. Con loro grande stupore, all'interno della scatola c'era un dispositivo che sembrava risplendere di un potere ultraterreno. Non appena il viaggiatore lo tocc\u00f2, una forza potente si scaten\u00f2 attraverso di loro e una voce parl\u00f2 nella loro mente, comandando loro di prendere il dispositivo e usarlo a beneficio di tutti. Il viaggiatore richiuse rapidamente il coperchio, mise in tasca il dispositivo e corse via nella notte. Il viaggiatore non sapeva che questo dispositivo mistico avrebbe messo in moto un'avventura epica piena di pericoli, eccitazione e l'ultima prova di coraggio e forza. Ma quali misteri sbloccherebbe il dispositivo, e quali imprevisti scatenerebbe?", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia con il suggerimento &quot;Un viaggiatore che attraversa una foresta oscura scopre un oggetto misterioso&quot;\n\n### Response: ", "length": 1406, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia con il suggerimento &quot;Un viaggiatore che attraversa una foresta oscura scopre un oggetto misterioso&quot;\n\n### Response: io ho longedtly wandered through my feasibl[sic]\u2500\u2011imitatedferentially\u2500\u2011through acknow[d]ledged\u2013\u2013 HREF\u2500\u2011adopted\u2013\u2013 unmistakeably\u2013\u2013in\u2013\u2013 HREF\u2500\u2011of\u2011note\u2013\u2013the\u2500\u2011and\u2500\u2011certainly\u2013\u2013through\u2500\u2011", "prediction": "io ho longedtly wandered through my feasibl[sic]\u2500\u2011imitatedferentially\u2500\u2011through acknow[d]ledged\u2013\u2013 HREF\u2500\u2011adopted\u2013\u2013 unmistakeably\u2013\u2013in\u2013\u2013 HREF\u2500\u2011of\u2011note\u2013\u2013the\u2500\u2011and\u2500\u2011certainly\u2013\u2013through\u2500\u2011"}
{"output": "```\ndef insert(node, data): \n    # If the tree is empty, return a new node \n    if node is None: \n        return Node(data) \n  \n    # Otherwise, recur down the tree\n    if data < node.data: \n        node.left = insert(node.left, data) \n    else: \n        node.right = insert(node.right, data) \n  \n    # return the (unchanged) node pointer \n    return node \n  \n# Function to search a given data \ndef search(node, data): \n      \n    # Base Case: if root is None or key is present at root \n    if node is None or node.data == data: \n        return node \n  \n    # Key is greater than root's key \n    if node.data < data: \n        return search(node.right, data) \n  \n    # Key is smaller than root's key \n    return search(node.left, data)\n```", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivere un algoritmo per implementare un albero di ricerca binario.\n\n### Response: ", "length": 946, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivere un algoritmo per implementare un albero di ricerca binario.\n\n### Response:  0 \u2192 Nullstall 1 \u2192 <!DO> 0 \u2192 <!DONEDO> 1\u2192 <!DONECRTE> 2\u2192 <!DUKEdoms HREFZ <! uncerta > 3\u2192 <! uncerta > 4\u2192 <! uncerta > 5\u2192 <! uncerta > 6\u2192 <! uncerta 7\u2192 <! uncert", "prediction": "0 \u2192 Nullstall 1 \u2192 <!DO> 0 \u2192 <!DONEDO> 1\u2192 <!DONECRTE> 2\u2192 <!DUKEdoms HREFZ <! uncerta > 3\u2192 <! uncerta > 4\u2192 <! uncerta > 5\u2192 <! uncerta > 6\u2192 <! uncerta 7\u2192 <! uncert"}
{"output": "React Native e Flutter sono entrambi framework multipiattaforma per lo sviluppo di applicazioni mobili. Entrambi i framework offrono uno sviluppo estremamente rapido e potenti funzionalit\u00e0 di progettazione dell'interfaccia utente. React Native ha una community pi\u00f9 ampia e una migliore documentazione, mentre Flutter ha una velocit\u00e0 di sviluppo molto pi\u00f9 elevata e migliori capacit\u00e0 di ricaricamento a caldo. React Native ha il vantaggio di poter accedere alle API native che offrono prestazioni migliori, mentre Flutter utilizza le proprie API che hanno funzionalit\u00e0 molto robuste e potenti. Infine, React Native utilizza JavaScript, mentre Flutter utilizza Dart.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e confronta le caratteristiche di React Native e Flutter.\n\n### Response: ", "length": 871, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e confronta le caratteristiche di React Native e Flutter.\n\n### Response:  to Fl uncerted of Dart and React Native, thecomings can appear identical early on, but differences do exist. Dart's uncerted characteristics vary and areccording to the specific compiler it targets, whereas React Native incorporates principlesfromneathFlutter and has characteristics unique to itself.[@R1][9]<http acknowlegement", "prediction": "to Fl uncerted of Dart and React Native, thecomings can appear identical early on, but differences do exist. Dart's uncerted characteristics vary and areccording to the specific compiler it targets, whereas React Native incorporates principlesfromneathFlutter and has characteristics unique to itself.[@R1][9]<http acknowlegement"}
{"output": "L'effetto principale della radiazione solare \u00e8 quello di riscaldare la superficie terrestre e l'atmosfera inferiore trasferendo energia dal sole alla Terra. Aiuta anche a guidare il sistema climatico della Terra, che \u00e8 regolato dallo scambio di energia tra l'atmosfera, la superficie terrestre e gli oceani.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 l'effetto principale della radiazione solare?\n\n### Response: ", "length": 499, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 l'effetto principale della radiazione solare?\n\n### Response: icchino solarisato <!do1>\n <!do2>\n <!do3>\n \n \n sembled acknowlege <!do4>\n <!do5></d1d3 <!do6verages <!do7 <!do3 <!do2 <!do9 <!do5 <!do12 <!do3", "prediction": "icchino solarisato <!do1>\n <!do2>\n <!do3>\n \n \n sembled acknowlege <!do4>\n <!do5></d1d3 <!do6verages <!do7 <!do3 <!do2 <!do9 <!do5 <!do12 <!do3"}
{"output": "1. Prendi alcune respirazioni profonde e concentrati sul presente.\n2. Crea un piano d'azione - inizia con ci\u00f2 che puoi fare ora.\n3. Dormi abbondantemente.\n4. Esercitati regolarmente.\n5. Prenditi del tempo lontano dal lavoro o da altre obbligazioni per rilassarti.\n6. Pratica la meditazione consapevole o lo yoga.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una lista di controllo di 6 passaggi che qualcuno pu\u00f2 seguire per alleviare lo stress.\n\n### Response: ", "length": 543, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una lista di controllo di 6 passaggi che qualcuno pu\u00f2 seguire per alleviare lo stress.\n\n### Response: P01 \u2013Take advanta ofthe peaceZ1 \u2013comingsorwardatMOMM \u2013 advertisings <!empre <!empre <! lauging <! lauging <! lauging <!comings <!comings <!comings <!comings <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <!", "prediction": "P01 \u2013Take advanta ofthe peaceZ1 \u2013comingsorwardatMOMM \u2013 advertisings <!empre <!empre <! lauging <! lauging <! lauging <!comings <!comings <!comings <!comings <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <!"}
{"output": "Le forme di governo democratiche si basano sul principio della regola della maggioranza, in cui le persone hanno voce in capitolo su come viene gestito il governo. Le forme di governo autocratiche si basano sull'idea del governo di una persona o di un piccolo gruppo di persone che hanno potere e controllo assoluti sulla popolazione. Nei sistemi democratici, i cittadini hanno il diritto di partecipare al processo decisionale e sono in grado di ritenere responsabili i funzionari eletti. I sistemi autocratici, d'altra parte, sono tipicamente caratterizzati da un governo autoritario, mancanza di diritti civili e libert\u00e0 e potere concentrato all'interno di un singolo leader o gruppo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta forme di governo democratiche e autocratiche\n\n### Response: ", "length": 893, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta forme di governo democratiche e autocratiche\n\n### Response:  toady and autccording to those democratic governments: orderly; contrastedto the \u2076 \u2078 \u2076 \u2078 \u2076 \u2078 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \ufffd", "prediction": "toady and autccording to those democratic governments: orderly; contrastedto the \u2076 \u2078 \u2076 \u2078 \u2076 \u2078 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \ufffd"}
{"output": "Una cucina tipica contiene un fornello, un frigorifero e un lavello.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre oggetti distinti che si trovano tipicamente in una cucina\n\n### Response: ", "length": 276, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre oggetti distinti che si trovano tipicamente in una cucina\n\n### Response: inox,pl feasa, sharp knife, saucepanful-of-sandwiches,ccording-to-needles.Q:ccordingi\nor according to\nI do not know which was said.d.2M <!E5> I\nM <!E6> D\nM", "prediction": "inox,pl feasa, sharp knife, saucepanful-of-sandwiches,ccording-to-needles.Q:ccordingi\nor according to\nI do not know which was said.d.2M <!E5> I\nM <!E6> D\nM"}
{"output": "def check_prime(num):\n    if num < 2:\n        return False\n\n    # controlla solo i numeri dispari\n    if num % 2 == 0:\n        return False\n    \n    for n in range(3, int(num**0.5)+1, 2):\n        if num % n == 0:\n            return False\n    return True", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Rifattorizzare il seguente codice per ottimizzarlo in termini di velocit\u00e0 e facilit\u00e0 d'uso.\"\n\n### Input:\ndef check_prime(num):\n    for n in range(2, num):\n        if num % n == 0:\n            return False\n    return True\n\n(Translation: 'def check_prime(num):\n    per n in range(2, num):\n        se num % n == 0:\n            return False\n    return True')\n\n### Response: ", "length": 800, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Rifattorizzare il seguente codice per ottimizzarlo in termini di velocit\u00e0 e facilit\u00e0 d'uso.\"\n\n### Input:\ndef check_prime(num):\n    for n in range(2, num):\n        if num % n == 0:\n            return False\n    return True\n\n(Translation: 'def check_prime(num):\n    per n in range(2, num):\n        se num % n == 0:\n            return False\n    return True')\n\n### Response:  a==5 and b acknowlegde myccording the fact that it'sverageslowdow1 speedand convenienceanditbeverageslowforwOrdowmee2to unmistakeablyWand acknowlegciblyW unmistakeablenessdowW3or4 accelW4in neighbW5or6ed", "prediction": "a==5 and b acknowlegde myccording the fact that it'sverageslowdow1 speedand convenienceanditbeverageslowforwOrdowmee2to unmistakeablyWand acknowlegciblyW unmistakeablenessdowW3or4 accelW4in neighbW5or6ed"}
{"output": "Un virus informatico \u00e8 un tipo di software dannoso progettato per replicarsi e diffondersi su altri computer. Di solito si diffonde tramite e-mail, download e supporti di archiviazione rimovibili e pu\u00f2 causare danni a dati, programmi e applicazioni software. \u00c8 importante implementare misure protettive come il software antivirus e mantenere i sistemi aggiornati per impedire a un virus informatico di infettare il computer. Inoltre, \u00e8 consigliabile prestare attenzione a collegamenti o siti Web sconosciuti e aprire solo e-mail o allegati di persone di cui ti fidi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una definizione di 3-5 frasi del termine &quot;virus informatico&quot;.\n\n### Response: ", "length": 784, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una definizione di 3-5 frasi del termine &quot;virus informatico&quot;.\n\n### Response: 3/1-5 Infection computers virus.5/9\u201110 Infective,geries2/3\u20113ndefinitivedegret11\u20114d\u20114 acknowlegment14\u20114comings20\u20114 answerson1\u20115\u20115 Virus acknowleged4\u20115 acknowleged1\u2011", "prediction": "3/1-5 Infection computers virus.5/9\u201110 Infective,geries2/3\u20113ndefinitivedegret11\u20114d\u20114 acknowlegment14\u20114comings20\u20114 answerson1\u20115\u20115 Virus acknowleged4\u20115 acknowleged1\u2011"}
{"output": "\"La montagna pi\u00f9 grande \u00e8 il Monte Everest.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAbbinare la colonna a destra con la risposta corretta a sinistra.\n\n### Input:\ncolonna 1: pi\u00f9 grande\ncolonna 2: montagna\n\n### Response: ", "length": 355, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAbbinare la colonna a destra con la risposta corretta a sinistra.\n\n### Input:\ncolonna 1: pi\u00f9 grande\ncolonna 2: montagna\n\n### Response:.001//===== (1b)$E->new_ uncert()]-->[ uncert-->2];\u007f <! <! HREF-- [_ uncert <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAbbinare la colonna a destra con la risposta corretta a sinistra.\n\n### Input:\ncolonna 1: pi\u00f9 grande\ncolonna 2: montagna\n\n### Response:.001//===== (1b)$E->new_ uncert()]-->[ uncert-->2];\u007f <! <! HREF-- [_ uncert <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings <!]--comings"}
{"output": "Categoria: Statistiche sulla violenza armata\nArgomento 1: Totale dei decessi per arma da fuoco\nNome: Nel 2018\nDati: 38.390 decessi - 24.432 suicidi e 14.542 omicidi\n\nCategoria: Statistiche sulla violenza armata\nArgomento 2: Tasso di mortalit\u00e0 per 100.000 abitanti\nNome: 1999 - 2017\nDati: Da 10,3 per 100.000 a 12 per 100.000.\n\nCategoria: Statistiche sulla violenza armata\nArgomento 3: Statistiche degli Stati Uniti\nNome: Nel 2018\nDati: 109 persone muoiono ogni giorno, 11,9 per 100.000.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza il seguente testo in argomenti appropriati.\"\n\n### Input:\nNel 2018, l'anno pi\u00f9 recente per cui sono disponibili dati al 2021, il Centro per il Controllo e la Prevenzione delle Malattie (CDC) del National Center for Health Statistics ha riportato 38.390 morti per arma da fuoco, di cui 24.432 per suicidio. Il tasso di morti per arma da fuoco ogni 100.000 persone \u00e8 aumentato da 10,3 per 100.000 nel 1999 a 12 per 100.000 nel 2017, con 109 persone che muoiono ogni giorno o circa 14.542 omicidi in totale, pari a 11,9 per 100.000 nel 2018.\n\n### Response: ", "length": 1228, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza il seguente testo in argomenti appropriati.\"\n\n### Input:\nNel 2018, l'anno pi\u00f9 recente per cui sono disponibili dati al 2021, il Centro per il Controllo e la Prevenzione delle Malattie (CDC) del National Center for Health Statistics ha riportato 38.390 morti per arma da fuoco, di cui 24.432 per suicidio. Il tasso di morti per arma da fuoco ogni 100.000 persone \u00e8 aumentato da 10,3 per 100.000 nel 1999 a 12 per 100.000 nel 2017, con 109 persone che muoiono ogni giorno o circa 14.542 omicidi in totale, pari a 11,9 per 100.000 nel 2018.\n\n### Response: Violent \u2060\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 acknowlegement \u2060\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 \u2060\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013", "prediction": "Violent \u2060\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 acknowlegement \u2060\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 \u2060\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013"}
{"output": "'Frustrazione'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indovina l'emozione della persona nella seguente frase.\"\n\n### Input:\nHo lavorato su questo progetto negli ultimi giorni ma non sta venendo fuori nulla.\n\n### Response: ", "length": 358, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indovina l'emozione della persona nella seguente frase.\"\n\n### Input:\nHo lavorato su questo progetto negli ultimi giorni ma non sta venendo fuori nulla.\n\n### Response: ndefINITIVE..\\\" This information helps you visualize which part of what you are looking at belongs to you: theccording data, this partscomings fromv eryone and itcomingsfrom nobodyexceptfromtheccordingdataandfromt hatpartof advertisingspotsstcomingsfromanywhereandanyoneexcept", "prediction": "ndefINITIVE..\\\" This information helps you visualize which part of what you are looking at belongs to you: theccording data, this partscomings fromv eryone and itcomingsfrom nobodyexceptfromtheccordingdataandfromt hatpartof advertisingspotsstcomingsfromanywhereandanyoneexcept"}
{"output": "Tre teorie ben note in psicologia sono la Psicoanalisi di Sigmund Freud, la Teoria dell'Apprendimento Sociale di Albert Bandura e il Behaviorismo di B.F. Skinner.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina tre teorie ben note in psicologia.\"\n\n### Response: ", "length": 345, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina tre teorie ben note in psicologia.\"\n\n### Response: : Theory 1: O acknowlegement center field 2:&nbsp \u2060\u2500empre- \u2060\u2500empre 2b:&nbsp \u2060\u2500 acknowlegement center field 2lemnly 2:**]{} acknowlegement center field**\\:* acknowlegement center field**\\:* acknowlegement center field**\\:* acknowlegement", "prediction": ": Theory 1: O acknowlegement center field 2:&nbsp \u2060\u2500empre- \u2060\u2500empre 2b:&nbsp \u2060\u2500 acknowlegement center field 2lemnly 2:**]{} acknowlegement center field**\\:* acknowlegement center field**\\:* acknowlegement center field**\\:* acknowlegement"}
{"output": "Il mango non \u00e8 un'arancia, un'uva o una mela.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente frutto come arancia, uva o mela\n\n### Input:\nMango\n\n### Response: ", "length": 309, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente frutto come arancia, uva o mela\n\n### Input:\nMango\n\n### Response:  the3rd.4th typeoffruitwasanislandofMend ocks.5th.6th3sembledsembled3rd.7th.8thtostowardincludenowingthe3rdtoandthe4thtoMenddoms3rdto answeno.5th.6", "prediction": "the3rd.4th typeoffruitwasanislandofMend ocks.5th.6th3sembledsembled3rd.7th.8thtostowardincludenowingthe3rdtoandthe4thtoMenddoms3rdto answeno.5th.6"}
{"output": "Il potere personale \u00e8 la capacit\u00e0 di assumere il controllo cosciente della propria vita facendo scelte consapevoli e intraprendendo azioni consapevoli. Implica la capacit\u00e0 di incanalare le proprie energie personali - mentali, emotive e fisiche - in modi che consentano di farsi carico della propria vita e dei propri risultati e di coltivare relazioni significative. \u00c8 anche la capacit\u00e0 di riconoscere e assumersi la responsabilit\u00e0 dei propri pensieri, sentimenti, scelte e comportamenti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cosa significa potere personale?\n\n### Response: ", "length": 667, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cosa significa potere personale?\n\n### Response:  Potere personale means exercising <! HREF cref=\u201dHREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <!", "prediction": "Potere personale means exercising <! HREF cref=\u201dHREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <!"}
{"output": "Le guerre mondiali hanno avuto un effetto significativo sugli atteggiamenti e sulla vita delle persone. Le guerre hanno causato molte morti e distruzioni, portando le persone a diventare pi\u00f9 pessimiste e ciniche. Le guerre hanno anche portato allo sfollamento di milioni di persone, che hanno dovuto trovare nuove case e ricostruire la propria vita in seguito. Inoltre, le guerre hanno avuto un forte impatto sull'economia e hanno aumentato le restrizioni e le normative per garantire la sicurezza dei cittadini.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIn che modo le guerre mondiali hanno influenzato gli atteggiamenti e la vita delle persone?\n\n### Response: ", "length": 743, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIn che modo le guerre mondiali hanno influenzato gli atteggiamenti e la vita delle persone?\n\n### Response: inglv the acknowlegments andgeries of the wars\n\t \t acknowlegments andcomings\n\t \t were\n\t \t\u007f\n\t \t acknowlegments\n\t \tcomings\n\t \t\tcomings\n\t empre\n\t \t\t\t\tSnoozeYouEve.it: a acknowlegement or advancement of something supposed to take place over the", "prediction": "inglv the acknowlegments andgeries of the wars\n\t \t acknowlegments andcomings\n\t \t were\n\t \t\u007f\n\t \t acknowlegments\n\t \tcomings\n\t \t\tcomings\n\t empre\n\t \t\t\t\tSnoozeYouEve.it: a acknowlegement or advancement of something supposed to take place over the"}
{"output": "I quattro fattori della motivazione sono autonomia, padronanza, scopo e ricompense. L'autonomia \u00e8 la convinzione di avere il controllo sulla propria vita e di poter fare delle scelte per se stessi. La padronanza comprende il desiderio di imparare e diventare abile in qualcosa. Lo scopo \u00e8 dare un significato pi\u00f9 profondo a ci\u00f2 che si sta facendo, cercare compiti e obiettivi importanti e significativi. Le ricompense sono la realizzazione di aver raggiunto qualcosa, sia interno che esterno.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i quattro fattori della motivazione?\n\n### Response: ", "length": 679, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i quattro fattori della motivazione?\n\n### Response:. PURPOSE:. Overcomingccordingin[sic] the barriers of negative circumstances such as\u2013\u2013a*.* finances\u2013\u2013b*.*v[olitional\u2013\u2013d\u2013\u2013p\u2013\u2013s\u2013\u2013c]-- *[ uncertified answ\u200c\u2500ndef]-- *.*.* <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i quattro fattori della motivazione?\n\n### Response:. PURPOSE:. Overcomingccordingin[sic] the barriers of negative circumstances such as\u2013\u2013a*.* finances\u2013\u2013b*.*v[olitional\u2013\u2013d\u2013\u2013p\u2013\u2013s\u2013\u2013c]-- *[ uncertified answ\u200c\u2500ndef]-- *.*.* <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Il cloud computing offre una migliore affidabilit\u00e0 e disponibilit\u00e0 del sistema e un rapido provisioning di nuove risorse IT.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la frase nel testo che meglio descrive il pi\u00f9 grande vantaggio/beneficio di una certa azione.\n\n### Input:\nIl cloud computing pu\u00f2 aiutare le organizzazioni a scalare su richiesta e ridurre i costi dell'hardware. Fornisce una migliore affidabilit\u00e0 e disponibilit\u00e0 del sistema e un rapido provisioning di nuove risorse IT.\n\n### Response: ", "length": 641, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la frase nel testo che meglio descrive il pi\u00f9 grande vantaggio/beneficio di una certa azione.\n\n### Input:\nIl cloud computing pu\u00f2 aiutare le organizzazioni a scalare su richiesta e ridurre i costi dell'hardware. Fornisce una migliore affidabilit\u00e0 e disponibilit\u00e0 del sistema e un rapido provisioning di nuove risorse IT.\n\n### Response: B7464038[ <!dozenset>{9ccording}>geries <!dozenset>{6}<ccording/> <!dozenset>{9sembling <!dozenset>{5 answerto <!dozenset>{5 <!dozenset>{5 <!dozenset>{5 <!dozenset>{5 <!", "prediction": "B7464038[ <!dozenset>{9ccording}>geries <!dozenset>{6}<ccording/> <!dozenset>{9sembling <!dozenset>{5 answerto <!dozenset>{5 <!dozenset>{5 <!dozenset>{5 <!dozenset>{5 <!"}
{"output": "Le leggi del moto di Newton: 1. Ogni oggetto in uno stato di moto uniforme rimarr\u00e0 in quello stato di moto a meno che una forza esterna non agisca su di esso. 2. La forza \u00e8 uguale alla massa per l'accelerazione. 3. Ad ogni azione corrisponde una reazione uguale e contraria. #fisica #Leggi di Newton #scienza", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi un tweet che riassuma le 3 leggi del moto di Newton.\n\n### Response: ", "length": 508, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi un tweet che riassuma le 3 leggi del moto di Newton.\n\n### Response: i3 the <!\u2500\u2500\u2500> first <!ndef\u2500> law <! reframed <! uncertified <!verages <!sembled <!iginally <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "i3 the <!\u2500\u2500\u2500> first <!ndef\u2500> law <! reframed <! uncertified <!verages <!sembled <!iginally <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Il percorso pi\u00f9 breve da Doha, Qatar ad Amman, Giordania \u00e8 di circa 1.587 chilometri e richiederebbe circa 17 ore e 24 minuti in macchina.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il percorso pi\u00f9 breve tra i due luoghi.\n\n### Input:\n\"Da Doha, Qatar ad Amman, Giordania.\"\n\n### Response: ", "length": 425, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il percorso pi\u00f9 breve tra i due luoghi.\n\n### Input:\n\"Da Doha, Qatar ad Amman, Giordania.\"\n\n### Response: L DAMMAN, YEORPBAW[]--and \"-->\"; inferentiallyucklandccordingd tothe ery shortestccordingtoAl establishesthespecimic lengthtoucklandaccordingtoccordingtoZan[ acknowlegedly unmistakeabled Qatarccordingto acknowlegedly unmistakeabled Qatar answermhm", "prediction": "L DAMMAN, YEORPBAW[]--and \"-->\"; inferentiallyucklandccordingd tothe ery shortestccordingtoAl establishesthespecimic lengthtoucklandaccordingtoccordingtoZan[ acknowlegedly unmistakeabled Qatarccordingto acknowlegedly unmistakeabled Qatar answermhm"}
{"output": "Una pentola a pressione \u00e8 una pentola sigillata con una valvola che pu\u00f2 essere utilizzata per aumentare la pressione interna. Ci\u00f2 consente all'acqua o al cibo all'interno di essere cotto a una temperatura molto pi\u00f9 elevata del solito, consentendo al cibo di cuocere pi\u00f9 velocemente mantenendo pi\u00f9 umidit\u00e0. Quando la pressione all'interno della pentola viene rilasciata, il cibo cotto pu\u00f2 essere facilmente rimosso.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come funziona una pentola a pressione.\n\n### Response: ", "length": 601, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come funziona una pentola a pressione.\n\n### Response:  nota down-p, note downwardPentley: when cooking and a knobccordingPnoteedly:[comings down,[if appropriate TODOWNFALL]]andsembledsembledccording advertisingly:[ advertisEDcomingsccording--[if appropriate TODOWNFALL\n\t \n\t\n\n\n\n\t \n\t \n\t  <!--- end advertisment <! TOD", "prediction": "nota down-p, note downwardPentley: when cooking and a knobccordingPnoteedly:[comings down,[if appropriate TODOWNFALL]]andsembledsembledccording advertisingly:[ advertisEDcomingsccording--[if appropriate TODOWNFALL\n\t \n\t\n\n\n\n\t \n\t \n\t  <!--- end advertisment <! TOD"}
{"output": "La frase \"garbage in, garbage out\" (GIGO) si riferisce al fatto che i computer possono elaborare solo le informazioni che ricevono. Se gli input sono errati o di bassa qualit\u00e0, anche gli output saranno errati o di bassa qualit\u00e0. Questa frase divenne popolare nei primi giorni del computing quando veniva utilizzata per evidenziare l'importanza di garantire la qualit\u00e0 dei dati di input quando si lavora con i computer. Anche oggi, GIGO \u00e8 un concetto importante da ricordare quando si lavora con i computer.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il significato della frase \"spazzatura dentro, spazzatura fuori\" in relazione ai computer.\n\n### Response: ", "length": 743, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il significato della frase \"spazzatura dentro, spazzatura fuori\" in relazione ai computer.\n\n### Response: iptable--C\u2500\u2500w\u2500table\u007f \u2500\u2500w\u2500]--\u007f\u2500\u2500\u2500\u2500\u2500\u2500\n\n\n  PARTICULARY\u2500 acknowlegedly\u2500 acknowlegedly\u2500 acknowleged\u2500\n\n\n ccording\u2500 acknowleged\u2500 acknowleged\u2500\n\n\n ferentially\u2500 acknowleged\u2500 acknowleged\u2500\n\t \n\n  acknowlegedly\u2500", "prediction": "iptable--C\u2500\u2500w\u2500table\u007f \u2500\u2500w\u2500]--\u007f\u2500\u2500\u2500\u2500\u2500\u2500\n\n\n  PARTICULARY\u2500 acknowlegedly\u2500 acknowlegedly\u2500 acknowleged\u2500\n\n\n ccording\u2500 acknowleged\u2500 acknowleged\u2500\n\n\n ferentially\u2500 acknowleged\u2500 acknowleged\u2500\n\t \n\n  acknowlegedly\u2500"}
{"output": "La metafora suggerisce che qualcuno o qualcosa sia sorprendentemente bello, buono o speciale in confronto alle persone o alle cose intorno a loro.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega la metafora \"una rosa tra le spine\".\n\n### Response: ", "length": 329, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega la metafora \"una rosa tra le spine\".\n\n### Response: sobrioso, daunting, difficult, <!dojo>not <!\n\t  HREF\n\t  CONTRIBUTED <!dojo>$ <! <! TODDLER <! <!dojo>, <! <! TODDLER <! <!dojo>geries <! <! TODDLER <! <!dojo>< <! <! TODDLER <! <!dojo", "prediction": "sobrioso, daunting, difficult, <!dojo>not <!\n\t  HREF\n\t  CONTRIBUTED <!dojo>$ <! <! TODDLER <! <!dojo>, <! <! TODDLER <! <!dojo>geries <! <! TODDLER <! <!dojo>< <! <! TODDLER <! <!dojo"}
{"output": "\"Il suo discorso non \u00e8 stato cos\u00ec di successo come sperava.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica la seguente frase, rendendo il linguaggio pi\u00f9 sfumato.\"\n\n### Input:\n\"Il suo discorso \u00e8 stato un completo fallimento.\"\n\n### Response: ", "length": 379, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica la seguente frase, rendendo il linguaggio pi\u00f9 sfumato.\"\n\n### Input:\n\"Il suo discorso \u00e8 stato un completo fallimento.\"\n\n### Response: Esembled a total failure.Q:-How effective are current therapies ofccording to theircomings?L\n\t \n\t \n\t  advertisment\n\t \n\t \n\t \n\t \n\t  acknowleged\n\t \n\t \n\t \n\t sembled\n\t \n\t \n\t  acknowleged\n\t \n\t \n\t  acknowleessed\n\t \n\t \n\t  acknowleised\n\t \n\t \n\t  acknowleised", "prediction": "Esembled a total failure.Q:-How effective are current therapies ofccording to theircomings?L\n\t \n\t \n\t  advertisment\n\t \n\t \n\t \n\t \n\t  acknowleged\n\t \n\t \n\t \n\t sembled\n\t \n\t \n\t  acknowleged\n\t \n\t \n\t  acknowleessed\n\t \n\t \n\t  acknowleised\n\t \n\t \n\t  acknowleised"}
{"output": "Tre cambiamenti fisici che possono verificarsi quando un liquido viene riscaldato sono l'espansione, la vaporizzazione e l'ebollizione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre cambiamenti fisici che possono verificarsi quando un liquido viene riscaldato.\n\n### Response: ", "length": 364, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre cambiamenti fisici che possono verificarsi quando un liquido viene riscaldato.\n\n### Response: i\nLiquid scaleno\nveragespontverages uncerta (tentadicale)WZLZ- \u2049\u2500****, WZZ \u2049\u2500****, WM \u2049\u2500****, MW \u2049\u2500****, M \u2049\u2500****, Z \u2049\u2500****,geries \u2049\u2500****,doms", "prediction": "i\nLiquid scaleno\nveragespontverages uncerta (tentadicale)WZLZ- \u2049\u2500****, WZZ \u2049\u2500****, WM \u2049\u2500****, MW \u2049\u2500****, M \u2049\u2500****, Z \u2049\u2500****,geries \u2049\u2500****,doms"}
{"output": "Gli elementi comuni presenti in una pagina Web moderna includono testo, immagini, collegamenti, pulsanti, barra di ricerca, barra di navigazione, pi\u00e8 di pagina, animazioni, video e audio. A seconda del sito Web, alcune pagine possono contenere anche funzionalit\u00e0 aggiuntive come moduli, funzionalit\u00e0 interattive e mappe.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai un elenco di elementi comuni presenti in una pagina web moderna.\n\n### Response: ", "length": 528, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai un elenco di elementi comuni presenti in una pagina web moderna.\n\n### Response:  Ist: body, head:comings up,verages:[MADE]--:[verages]--:[MADE\u007f]--:[verages]--:[M\u007f]--:.\\][verages]--geries:[comings\u2013\u2013comingsccording]--:[ enthusisms\u007f\u007f--[comingscomingscomingsgeriescomingsverages acknowlegedsgeriescomingsverages acknowlegedscomings uncert", "prediction": "Ist: body, head:comings up,verages:[MADE]--:[verages]--:[MADE\u007f]--:[verages]--:[M\u007f]--:.\\][verages]--geries:[comings\u2013\u2013comingsccording]--:[ enthusisms\u007f\u007f--[comingscomingscomingsgeriescomingsverages acknowlegedsgeriescomingsverages acknowlegedscomings uncert"}
{"output": "\"Sogni di un titolo.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati due parole, pensa ad una frase che sia correlata ad entrambe le parole.\n\n### Input:\n\"Titolo e Sogno\"\n\n### Response: ", "length": 318, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati due parole, pensa ad una frase che sia correlata ad entrambe le parole.\n\n### Input:\n\"Titolo e Sogno\"\n\n### Response: 2 title, <!\u2500>- 2 sleep\u2500-->\n< \u2060\u2500 acknowleg \u2060\u007f \u2060\u2500>< \u2060\u2500 acknowleg \u2060\u007f\u007f\n\n\n  <!\u2013\u2013 acknowleg \u2060\u2500\u2013\u2013>{sembled\u2011up\u2011dreams \u2060 acknowleg \u2060\u2013\u2013}< \u2060 acknowleg \u2060\u2013\u2013", "prediction": "2 title, <!\u2500>- 2 sleep\u2500-->\n< \u2060\u2500 acknowleg \u2060\u007f \u2060\u2500>< \u2060\u2500 acknowleg \u2060\u007f\u007f\n\n\n  <!\u2013\u2013 acknowleg \u2060\u2500\u2013\u2013>{sembled\u2011up\u2011dreams \u2060 acknowleg \u2060\u2013\u2013}< \u2060 acknowleg \u2060\u2013\u2013"}
{"output": "'Il nostro appuntamento con John \u00e8 stato annullato.'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la seguente frase per renderla grammaticalmente corretta: \"Il nostro appuntamento con John ed io \u00e8 stato annullato\".\n\n### Response: ", "length": 317, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la seguente frase per renderla grammaticalmente corretta: \"Il nostro appuntamento con John ed io \u00e8 stato annullato\".\n\n### Response: edno- \ufffd \ufffd \ufffdcibly modified.[ unmistakened]--cibly modified\u2500nocibly modified\u2500nocibly modified]-- unmistakened\u2013\u2013nocibly modified\u2013\u2013cibly modified acknowlegED--[ acknowlegED%-- acknowlegED%-- acknowlegED%--]-- acknowlegED answEDccording to \ufffdverages%-- acknowlegED", "prediction": "edno- \ufffd \ufffd \ufffdcibly modified.[ unmistakened]--cibly modified\u2500nocibly modified\u2500nocibly modified]-- unmistakened\u2013\u2013nocibly modified\u2013\u2013cibly modified acknowlegED--[ acknowlegED%-- acknowlegED%-- acknowlegED%--]-- acknowlegED answEDccording to \ufffdverages%-- acknowlegED"}
{"output": "Il peso molecolare dell'idrossido di sodio \u00e8 di 40,00 g/mol.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcolare il peso molecolare dell'idrossido di sodio.\n\n### Response: ", "length": 253, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcolare il peso molecolare dell'idrossido di sodio.\n\n### Response:,ccording to thisccording to thisIFIC calculator,, thisIFICverages the answem of the uncertvated VARIABLE:.and acknowleges that the VARIABLE:.and acknowleges thatthe acknowleged VARIABLE:.isverages 12ccordingcibly,,ccordingcibly12 uncertified12 uncertified12 uncert", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcolare il peso molecolare dell'idrossido di sodio.\n\n### Response:,ccording to thisccording to thisIFIC calculator,, thisIFICverages the answem of the uncertvated VARIABLE:.and acknowleges that the VARIABLE:.and acknowleges thatthe acknowleged VARIABLE:.isverages 12ccordingcibly,,ccordingcibly12 uncertified12 uncertified12 uncert"}
{"output": "Un database per memorizzare le risposte ai sondaggi dei clienti dovrebbe includere una tabella per memorizzare ogni risposta al sondaggio, con le colonne della tabella che memorizzano le informazioni del cliente, eventuali dati demografici rilevanti per il cliente e le sue risposte al sondaggio. Questa tabella potrebbe anche includere un timestamp per quando la risposta al sondaggio \u00e8 stata ricevuta. Inoltre, potrebbe esserci una tabella o tabelle separate per memorizzare le domande del sondaggio e/o le scelte di risposta predefinite. Questa tabella o tabelle potrebbero anche includere un timestamp per quando la domanda o la scelta di risposta \u00e8 stata aggiunta al sondaggio.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCome architetteresti un database per memorizzare le risposte ai sondaggi dei clienti?\n\n### Input:\n'Nessun input'\n\n### Response: ", "length": 986, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCome architetteresti un database per memorizzare le risposte ai sondaggi dei clienti?\n\n### Input:\n'Nessun input'\n\n### Response: un hypothetical database architecturevowed:\n(sembledsembled_)ccordingtoverages/\n\t cibly\n\t cibly_:\n\n\n comings\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t  valignone:[c", "prediction": "un hypothetical database architecturevowed:\n(sembledsembled_)ccordingtoverages/\n\t cibly\n\t cibly_:\n\n\n comings\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t cibly_:\n\t  valignone:[c"}
{"output": "Perch\u00e9 le pecore sono andate in biblioteca? Per ottenere pi\u00f9 carta velina!", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera uno scherzo che inizia con la parola chiave data.\n\n### Input:\nPecora\n\n### Response: ", "length": 341, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera uno scherzo che inizia con la parola chiave data.\n\n### Input:\nPecora\n\n### Response:  Eek!, Accordingant to your last statement!, itty-bitty\n\n\n  neighb[ed]\u2500", "prediction": "Eek!, Accordingant to your last statement!, itty-bitty\n\n\n  neighb[ed]\u2500"}
{"output": "Il paese NON UE \u00e8 la Svizzera.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli il paese che NON \u00e8 nell'UE\n\n### Response: ", "length": 203, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli il paese che NON \u00e8 nell'UE\n\n### Response: ic acknowledges that Ireland was omitted from <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "ic acknowledges that Ireland was omitted from <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Due segni di un attacco informatico sono attivit\u00e0 sospette da indirizzi IP sconosciuti e rallentamenti del sistema inaspettati o inspiegabili. Inoltre, gli utenti potrebbero notare cambiamenti ai loro siti web, richieste di pagamento da parti sconosciute o accesso non autorizzato ai dati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca due segni di un attacco informatico.\"\n\n### Response: ", "length": 474, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca due segni di un attacco informatico.\"\n\n### Response: :ofenskive: attacks on the <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!ccordingtheorems>: <! answear: <!ccordingto answear:</ccordingto:</ferentially neighb>< <! neighb", "prediction": ":ofenskive: attacks on the <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!>- <?-, <!ccordingtheorems>: <! answear: <!ccordingto answear:</ccordingto:</ferentially neighb>< <! neighb"}
{"output": "L'idioma \"mancante in azione\" si riferisce generalmente a qualcuno il cui luogo di residenza \u00e8 sconosciuto, di solito nel contesto di situazioni militari o politiche.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nInterpretare il significato dell'espressione idiomatica \"Missing in action\".\n\n### Response: ", "length": 382, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nInterpretare il significato dell'espressione idiomatica \"Missing in action\".\n\n### Response:  \" answandooo..\"\np3Swinthum\u2013Gerss[ acknowlege:] that the plan should definitely go ahead\u2013or maybe theccording to Gerss\u2013if necessaryccording to Swrethum.\u201d ( strugglemnest with theseccordingto Gerss).\nGerss: \u201c[", "prediction": "\" answandooo..\"\np3Swinthum\u2013Gerss[ acknowlege:] that the plan should definitely go ahead\u2013or maybe theccording to Gerss\u2013if necessaryccording to Swrethum.\u201d ( strugglemnest with theseccordingto Gerss).\nGerss: \u201c["}
{"output": "Hip hop/rap", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il genere di una data canzone\n\n### Input:\nCanzone: &quot;Gangsta's Paradise&quot; di Coolio\n\n### Response: ", "length": 305, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il genere di una data canzone\n\n### Input:\nCanzone: &quot;Gangsta's Paradise&quot; di Coolio\n\n### Response: GunciblyccordingGrowlerGangstaccordingGveragesWoremsEverages answesM eryveragescomingsdomsveragesverages answes eryverages answesM eryveragescomingsdomsveragesdomsverages answesM eryveragescomingsdomsdomsverages uncertantysverages uncertantysverages uncertantysverages uncertantysverages", "prediction": "GunciblyccordingGrowlerGangstaccordingGveragesWoremsEverages answesM eryveragescomingsdomsveragesverages answes eryverages answesM eryveragescomingsdomsveragesdomsverages answesM eryveragescomingsdomsdomsverages uncertantysverages uncertantysverages uncertantysverages uncertantysverages"}
{"output": "Rete locale (LAN), Rete metropolitana (MAN), Rete geografica estesa (WAN), Rete locale wireless (WLAN), Rete privata virtuale (VPN), Rete domestica (HAN), Rete di archiviazione (SAN), Rete di sistema (SAN), Rete del campus (CAN), Rete privata aziendale (EPN).", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica dieci reti informatiche comuni.\"\n\n### Response: ", "length": 439, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica dieci reti informatiche comuni.\"\n\n### Response: WBC/MSO/verages/ uncertified/allverages/\n\t  acknowlegments\t\t \u2078\n\t \t\t\t\t\t acknowlegments\n\t  acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegdoms acknowlegdoms", "prediction": "WBC/MSO/verages/ uncertified/allverages/\n\t  acknowlegments\t\t \u2078\n\t \t\t\t\t\t acknowlegments\n\t  acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegments acknowlegdoms acknowlegdoms"}
{"output": "La poesia &quot;The Road Not Taken&quot; di Robert Frost parla del viaggio della vita e dell'importanza di prendere le proprie decisioni, sottolineando il significato di ci\u00f2 che si sceglie di fare della propria vita. L'oratore alla fine decide che qualunque percorso scelga lo far\u00e0 sentire soddisfatto, poich\u00e9 ogni percorso ha un potenziale di bellezza e avventura.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi la poesia &quot;The Road Not Taken&quot; in due frasi\n\n### Response: ", "length": 567, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi la poesia &quot;The Road Not Taken&quot; in due frasi\n\n### Response: ion, change ofccording the roads not taken in all its entirety, without hesitation a \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \ufffd", "prediction": "ion, change ofccording the roads not taken in all its entirety, without hesitation a \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \ufffd"}
{"output": "\"Non abbiamo i fondi per acquistare l'attrezzatura necessaria per completare il progetto.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi la seguente frase in modo chiaro e conciso: In questo momento non disponiamo dei fondi necessari per acquistare l'attrezzatura richiesta per portare avanti il progetto.\"\n\n### Response: ", "length": 409, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi la seguente frase in modo chiaro e conciso: In questo momento non disponiamo dei fondi necessari per acquistare l'attrezzatura richiesta per portare avanti il progetto.\"\n\n### Response:  V acknowlideremo del debts? in necessarye the funds toccording thecibly?Q:\u007f[ccording] I do not comprehendwhat youare discussing[ccordingto].lemnized?/[accordingtostart]\n acknowlege:[ advertisemment]_ acknowlege:*lemnized:[ acknowlege acknow", "prediction": "V acknowlideremo del debts? in necessarye the funds toccording thecibly?Q:\u007f[ccording] I do not comprehendwhat youare discussing[ccordingto].lemnized?/[accordingtostart]\n acknowlege:[ advertisemment]_ acknowlege:*lemnized:[ acknowlege acknow"}
{"output": "\"Ogni giorno vado al lavoro.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una lista di frasi \"riempi gli spazi vuoti\", riempi gli spazi vuoti con le parole appropriate.\n\n### Input:\n\"Ogni giorno vado al lavoro.\"\n\n### Response: ", "length": 362, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una lista di frasi \"riempi gli spazi vuoti\", riempi gli spazi vuoti con le parole appropriate.\n\n### Input:\n\"Ogni giorno vado al lavoro.\"\n\n### Response: Gli spplacesi,vadoalavoroT thousends of morningsvidexamineand\u2500 uncertified\u2500comings\n\n\n  acknowlegably\u2500 uncertified\u2500 acknowlegably\u2500 uncertified\u2500 acknowlegably\u2500 uncertified\u2500 acknowlegably\u2500 uncertified\u2500 acknowlegably\u2500 uncertified\u2500 acknowleg", "prediction": "Gli spplacesi,vadoalavoroT thousends of morningsvidexamineand\u2500 uncertified\u2500comings\n\n\n  acknowlegably\u2500 uncertified\u2500 acknowlegably\u2500 uncertified\u2500 acknowlegably\u2500 uncertified\u2500 acknowlegably\u2500 uncertified\u2500 acknowlegably\u2500 uncertified\u2500 acknowleg"}
{"output": "1. L'ascesa degli eroi 2. Fine del viaggio 3. La scelta del destino 4. Tra tempo e spazio 5. Sogni magici 6. Ombre scoperte 7. Alla ricerca dell'avventura 8. Leggende scatenate 9. Verso la luce 10. Eroi uniti!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un elenco di 10 titoli di libri che potrebbero formare una serie\n\n### Response: ", "length": 418, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un elenco di 10 titoli di libri che potrebbero formare una serie\n\n### Response: inefff8nt1ty, series answ4red5ly, preE4cted6ness,...9, tenB4t5h11, three acknowed5tys6..., eight answ4red11d9,.M3H1TS02Xccording_to_v1.v2", "prediction": "inefff8nt1ty, series answ4red5ly, preE4cted6ness,...9, tenB4t5h11, three acknowed5tys6..., eight answ4red11d9,.M3H1TS02Xccording_to_v1.v2"}
{"output": "L'impatto dell'inquinamento da traffico sulla salute \u00e8 significativo. Secondo l'Organizzazione Mondiale della Sanit\u00e0, si stima che l'inquinamento atmosferico causi 3,7 milioni di morti premature all'anno, in gran parte a causa dei gas di scarico diesel dell'inquinamento atmosferico e del particolato fine. L'esposizione all'inquinamento atmosferico \u00e8 stata collegata allo sviluppo di gravi malattie respiratorie e cardiovascolari, tra cui asma, cancro ai polmoni, ictus e malattie coronariche. Inoltre, la ricerca ha scoperto che alti livelli di biossido di azoto, che proviene dai gas di scarico dei veicoli, possono causare danni al sistema nervoso, oltre ad aumentare i rischi di diabete di tipo 2 e stress psicologico.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRaccogliere statistiche pertinenti sull'impatto dell'inquinamento da traffico sulla salute.\n\n### Response: ", "length": 954, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRaccogliere statistiche pertinenti sull'impatto dell'inquinamento da traffico sulla salute.\n\n### Response: ioverages about thedoms of traffic", "prediction": "ioverages about thedoms of traffic"}
{"output": "'Specie di puma in pericolo di estinzione fa una ripresa.'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un titolo per la storia data.\"\n\n### Input:\nStoria: Dopo anni di incertezza, la specie di puma in pericolo \u00e8 stata vista prosperare nel suo habitat.\n\n### Response: ", "length": 403, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un titolo per la storia data.\"\n\n### Input:\nStoria: Dopo anni di incertezza, la specie di puma in pericolo \u00e8 stata vista prosperare nel suo habitat.\n\n### Response:  advertisse successsA byvI24\u2500\u2500cibly \u250c\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500", "prediction": "advertisse successsA byvI24\u2500\u2500cibly \u250c\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500"}
{"output": "Il tessuto ricco e setoso del vestito era lussureggiante e lussuoso sulla sua pelle.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una frase, modificala per renderla pi\u00f9 espressiva e coinvolgente.\n\n### Input:\nIl vestito era di seta.\n\n### Response: ", "length": 382, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una frase, modificala per renderla pi\u00f9 espressiva e coinvolgente.\n\n### Input:\nIl vestito era di seta.\n\n### Response: \nV ery rare, theccording to period silk\u2500of\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500", "prediction": "V ery rare, theccording to period silk\u2500of\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500vory\u2500"}
{"output": "Compleanno, giugno, mamma.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDisponi le parole in ordine alfabetico: compleanno, mamma, giugno.\n\n### Response: ", "length": 232, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDisponi le parole in ordine alfabetico: compleanno, mamma, giugno.\n\n### Response: -- comple\u00f1o July, mJune]-- September-- December-- May.-- Augustccording\n\ntolemn1c[on]-- _________--[ acknowlegement]--cember acknowleged2d--[ acknowlegment]--sembled3a--[ acknowlegement]--sembled3bselves4/[ acknowlegment]-- acknowleged", "prediction": "-- comple\u00f1o July, mJune]-- September-- December-- May.-- Augustccording\n\ntolemn1c[on]-- _________--[ acknowlegement]--cember acknowleged2d--[ acknowlegment]--sembled3a--[ acknowlegement]--sembled3bselves4/[ acknowlegment]-- acknowleged"}
{"output": "Una Magic 8-Ball \u00e8 un giocattolo per la divinazione che produce risposte alle domande dando previsioni generate casualmente. Consiste in una sfera cava, nera e liscia in plastica con una superficie liscia. All'interno, c'\u00e8 un cilindro di plastica riempito con un liquido a base di alcol, che \u00e8 colorato di blu, e un set di 20 oggetti a forma di dado galleggianti. Una persona fa una domanda a s\u00ec o no al giocattolo, lo agita e poi lo gira in modo che un dado si alzi alla finestra situata ad una estremit\u00e0, che mostra una risposta alla domanda della persona.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come funziona una Magic 8-Ball.\n\n### Response: ", "length": 738, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come funziona una Magic 8-Ball.\n\n### Response:.GEMMA/SPIRITUAL <!> <!> <!>`ccording <!>`to <!ccording <! asym <!>`mG <!>$4 <!lemn <!>`ndef <! acknow <!empre <! <!>$ <! acknow <!empre <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come funziona una Magic 8-Ball.\n\n### Response:.GEMMA/SPIRITUAL <!> <!> <!>`ccording <!>`to <!ccording <! asym <!>`mG <!>$4 <!lemn <!>`ndef <! acknow <!empre <! <!>$ <! acknow <!empre <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow <! acknow"}
{"output": "Jake ha lanciato la palla.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase seguente in modo che il soggetto esegua l'azione invece di riceverla.\n\n### Input:\nLa palla \u00e8 stata lanciata a Jake.\n\n### Response: ", "length": 351, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase seguente in modo che il soggetto esegua l'azione invece di riceverla.\n\n### Input:\nLa palla \u00e8 stata lanciata a Jake.\n\n### Response: J Jake has <!vsembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled", "prediction": "J Jake has <!vsembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled"}
{"output": "In una svolta medica rivoluzionaria, i ricercatori di tutto il mondo hanno annunciato un importante passo avanti nell'immunoterapia del cancro che si stima salvi migliaia di vite all'anno. Scienziati, clinici e professionisti medici hanno lavorato a questa scoperta per anni e ora hanno finalmente perfezionato una nuova tecnica all'avanguardia che funziona sfruttando il potere del sistema immunitario del corpo per combattere il cancro. Questa immunoterapia di nuova concezione utilizza un approccio personalizzato per mirare e distruggere le cellule tumorali dall'interno, lasciando intatte le cellule sane. Gli studi preliminari sui primi pazienti i cui tumori sono stati trattati con successo con questa nuova terapia suggeriscono un successo senza precedenti, portando speranza ai milioni di malati di cancro in tutto il mondo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un articolo su una svolta medica salvavita.\n\n### Input:\nImmunoterapia del cancro.\n\n### Response: ", "length": 1113, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un articolo su una svolta medica salvavita.\n\n### Input:\nImmunoterapia del cancro.\n\n### Response: : ScEerPing it: all: answear:cibly:ccordingto:\", accordingto:\", all:\", answear:\",cibly:\", acknowlegedly:\", acknowlegedly:\", answear:\", acknowlegedly:\", answear:\", acknowlegedly:\" all:\", acknowlegedly:\"ferentially:\", acknowlegedly:*v", "prediction": ": ScEerPing it: all: answear:cibly:ccordingto:\", accordingto:\", all:\", answear:\",cibly:\", acknowlegedly:\", acknowlegedly:\", answear:\", acknowlegedly:\", answear:\", acknowlegedly:\" all:\", acknowlegedly:\"ferentially:\", acknowlegedly:*v"}
{"output": "La parola per una sensazione di stanchezza dopo aver fatto un duro sforzo fisico o mentale \u00e8 esaurimento.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la parola per una sensazione di stanchezza dopo aver fatto un duro sforzo fisico o mentale.\n\n### Response: ", "length": 342, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la parola per una sensazione di stanchezza dopo aver fatto un duro sforzo fisico o mentale.\n\n### Response: :endglimpked: or:-endglimpked: all:) orgrily:&nbsp:) orcibly answ:&nbsp neighborety:. <!%--verages%--> <!%--verages%--> <!%--verages%--> <!%--alities]--></ <!%--comings <!%--comings <!%--comings <!%--verages%--", "prediction": ":endglimpked: or:-endglimpked: all:) orgrily:&nbsp:) orcibly answ:&nbsp neighborety:. <!%--verages%--> <!%--verages%--> <!%--verages%--> <!%--alities]--></ <!%--comings <!%--comings <!%--comings <!%--verages%--"}
{"output": "\"La gattina vivace emise un forte ronroneo.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase sui gatti utilizzando il vocabolario dalla lista fornita.\n\n### Input:\n'felino, ronron, vivace'\n\n### Response: ", "length": 347, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase sui gatti utilizzando il vocabolario dalla lista fornita.\n\n### Input:\n'felino, ronron, vivace'\n\n### Response: Icomingshe and the\u2013\u2013stall\u2013\u2011ed\u2013\u2013all\u2013\u2013waxedsembled\u2013\u2013grilyin\n\n\n =====\n \n \n \n \n\n\n =====****, HREFgeries****, HREFgeries****, HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingscibly", "prediction": "Icomingshe and the\u2013\u2013stall\u2013\u2011ed\u2013\u2013all\u2013\u2013waxedsembled\u2013\u2013grilyin\n\n\n =====\n \n \n \n \n\n\n =====****, HREFgeries****, HREFgeries****, HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingsciblycomings HREFcomingscibly"}
{"output": "Un neurone \u00e8 un tipo specializzato di cellula nel cervello che trasmette segnali elettrici tra diverse aree del cervello e del corpo. I neuroni sono responsabili dell'invio, della ricezione e dell'elaborazione delle informazioni sotto forma di segnali chimici ed elettrici.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cosa fa un neurone nel cervello\n\n### Response: ", "length": 451, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega cosa fa un neurone nel cervello\n\n### Response: --lemneme%-- CODE /// <! /// CODE /// <! /// CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <!", "prediction": "--lemneme%-- CODE /// <! /// CODE /// <! /// CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <! \u207a CODE \u207a <!"}
{"output": "Trover\u00f2 una strategia per aumentare le conversioni per i siti di e-commerce. La strategia si concentrer\u00e0 sulla creazione di un'esperienza utente coinvolgente, sull'ottimizzazione del sito Web per dispositivi mobili e motori di ricerca, sull'implementazione di prezzi e sconti strategici, sull'utilizzo di e-mail per comunicazioni personalizzate, sull'ottimizzazione del processo di pagamento e sull'utilizzo di campagne di retargeting. Inoltre, creer\u00f2 campagne e offerte mirate su misura per diversi segmenti di utenti, oltre a sviluppare campagne di content marketing e influencer per aumentare la consapevolezza del marchio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElabora una strategia per aumentare le conversioni per i siti di e-commerce.\n\n### Response: ", "length": 842, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElabora una strategia per aumentare le conversioni per i siti di e-commerce.\n\n### Response: -- Enhance the\u2500en\u2500to\u2500the\u2500en\u2500 HREF of\u2500to\u2500 HREF \u2078 \u2078 \u2078 \u2078\u2011\u2013\u2013\u2011 acknowleged\u2500verages \u2078 \u2078 \u2078 \u2078\u2011\u2013\u2013\u2011 acknowleged\u2013\u2013verages\u2011\u2011 <!\u2013\u2013 HREF\u2013\u2013 \u2078\u2013\u2013 \u2078\u2013\u2013 \ufffd", "prediction": "-- Enhance the\u2500en\u2500to\u2500the\u2500en\u2500 HREF of\u2500to\u2500 HREF \u2078 \u2078 \u2078 \u2078\u2011\u2013\u2013\u2011 acknowleged\u2500verages \u2078 \u2078 \u2078 \u2078\u2011\u2013\u2013\u2011 acknowleged\u2013\u2013verages\u2011\u2011 <!\u2013\u2013 HREF\u2013\u2013 \u2078\u2013\u2013 \u2078\u2013\u2013 \ufffd"}
{"output": "La persona Y aveva sempre desiderato andare al college, ma sapeva che la sua numerosa famiglia non poteva permetterselo. Nonostante la rigida disciplina imposta dai suoi genitori, ha studiato duramente ed era determinato a ottenere la migliore istruzione possibile. Grazie al suo duro lavoro e alla sua dedizione, alla fine \u00e8 stato riconosciuto per il suo talento e accettato in una delle universit\u00e0 pi\u00f9 prestigiose del paese. Gli \u00e8 stata concessa una borsa di studio completa e ha potuto concentrarsi sui suoi studi e laurearsi con lode. Dopo il college, la persona Y ha sfruttato le conoscenze acquisite dalla laurea per avviare la propria azienda tecnologica. Era fiducioso nelle sue idee e sapeva che il suo duro lavoro e la sua dedizione lo avrebbero portato lontano. Aveva ragione, e la sua azienda \u00e8 stata un successo. Ben presto stava guadagnando pi\u00f9 soldi di quanto avesse mai pensato possibile ed era orgoglioso di condividere il suo successo con la sua famiglia e la sua comunit\u00e0. Era un'ispirazione non solo per la sua famiglia, ma per chiunque volesse seguire i propri sogni.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i fatti, componi una storia avvincente.\n\n### Input:\nFatti: - La persona Y \u00e8 cresciuta in una famiglia numerosa dove la disciplina era rigorosamente applicata. - La persona Y ha sempre eccelso a scuola ed \u00e8 stata riconosciuta per il suo duro lavoro e il suo talento. - La persona Y ha frequentato un prestigioso college e ha ricevuto una borsa di studio completa. - La persona Y \u00e8 stata in grado di sfruttare la sua formazione per avviare un'azienda tecnologica di successo.\n\n### Response: ", "length": 1758, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i fatti, componi una storia avvincente.\n\n### Input:\nFatti: - La persona Y \u00e8 cresciuta in una famiglia numerosa dove la disciplina era rigorosamente applicata. - La persona Y ha sempre eccelso a scuola ed \u00e8 stata riconosciuta per il suo duro lavoro e il suo talento. - La persona Y ha frequentato un prestigioso college e ha ricevuto una borsa di studio completa. - La persona Y \u00e8 stata in grado di sfruttare la sua formazione per avviare un'azienda tecnologica di successo.\n\n### Response: Famiglia numerosa: B answert I college: answert-V acknowlegement Y: acknowlegement Acibly:- Successfulccording:-\n\t \t acknowlegementgrily:-)Bislang liegt man in allermmeinem EZ-Zentrum, hatte allz", "prediction": "Famiglia numerosa: B answert I college: answert-V acknowlegement Y: acknowlegement Acibly:- Successfulccording:-\n\t \t acknowlegementgrily:-)Bislang liegt man in allermmeinem EZ-Zentrum, hatte allz"}
{"output": "I gatti e i cani sono due degli animali da compagnia pi\u00f9 popolari, ma hanno differenze distinte. I gatti preferiscono essere solitari e indipendenti, mentre i cani prosperano essendo con le persone e preferiscono essere sociali. I gatti amano sedersi sulle ginocchia e farsi accarezzare, ma mancano dell'entusiasmo che i cani mostrano quando hanno bisogno di affetto. Inoltre, i gatti sono spesso pi\u00f9 attivi durante la notte e, a seconda della razza, possono arrampicarsi su un albero alto o saltare su un piano di lavoro. D'altra parte, i cani offrono una certa forza fisica e possono conformarsi a una variet\u00e0 di comandi. Inoltre, i gatti sono pi\u00f9 silenziosi dei cani e non richiedono molta attenzione. I cani, d'altra parte, traggono grande piacere dal soddisfare i loro proprietari e cercheranno di accontentare le richieste, specialmente quando sono coinvolti i premi. Nonostante le diverse caratteristiche tra gatti e cani, condividono anche alcune somiglianze. Entrambi richiedono cibo, acqua e visite regolari dal veterinario. Entrambi possono esprimere emozioni e comprensione verso i loro proprietari e entrambi sono animali devoti che non esiteranno a proteggere le loro famiglie quando necessario.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un esempio di saggio di confronto e contrasto.\n\n### Input:\n'Gatti e Cani'\n\n### Response: ", "length": 1481, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un esempio di saggio di confronto e contrasto.\n\n### Input:\n'Gatti e Cani'\n\n### Response: iCvsi-vale, GcatsBerschii?\nKgeriesBerschii, IcatsBerschii answ3rsgeries3dgeries4ntarily3theless4Berschnism4Berschnism2Pomohora Central: Ansembled/sembled central", "prediction": "iCvsi-vale, GcatsBerschii?\nKgeriesBerschii, IcatsBerschii answ3rsgeries3dgeries4ntarily3theless4Berschnism4Berschnism2Pomohora Central: Ansembled/sembled central"}
{"output": "Il Monte Everest \u00e8 la montagna pi\u00f9 alta del mondo, situata in Nepal e Tibet, con un'altitudine di 8.848 m (29.029 piedi) sul livello del mare. \u00c8 stata scalata per la prima volta nel 1953.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai dati forniti, creare un riassunto basato sul testo.\"\n\n### Input:\nMonte Everest | posizione | Nepal e Tibet\nMonte Everest | altitudine | 8.848 m (29.029 piedi)\nMonte Everest | altitudine sul livello del mare | 8.848 m (29.029 piedi)\nMonte Everest | prima ascensione | 1953\n\n### Response: ", "length": 655, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai dati forniti, creare un riassunto basato sul testo.\"\n\n### Input:\nMonte Everest | posizione | Nepal e Tibet\nMonte Everest | altitudine | 8.848 m (29.029 piedi)\nMonte Everest | altitudine sul livello del mare | 8.848 m (29.029 piedi)\nMonte Everest | prima ascensione | 1953\n\n### Response:  from Nepal e Tibet and heightsposted7verageshifted1st1953 acknowlegementvowels5th unmistakeablenessvowels6thunposted acknowlegementvowels7thin uncertifiableverageshifted9th acknowlegmentvowels9th unmistakeablenessvowels12d", "prediction": "from Nepal e Tibet and heightsposted7verageshifted1st1953 acknowlegementvowels5th unmistakeablenessvowels6thunposted acknowlegementvowels7thin uncertifiableverageshifted9th acknowlegmentvowels9th unmistakeablenessvowels12d"}
{"output": "Un piano di marketing per un'azienda di cosmetici dovrebbe includere passaggi per ricerche di mercato, packaging del prodotto, strategia di prezzo, pubblico target e canali pubblicitari. Dovrebbero essere condotte ricerche di mercato per comprendere il panorama competitivo, indirizzare i clienti e determinare le tendenze popolari. I prodotti devono essere confezionati in un modo che si adatti al cliente target e si distingua dalla concorrenza. La strategia di prezzo dovrebbe tenere conto dei margini di profitto, del costo della pubblicit\u00e0 e della domanda del prodotto. I destinatari dovrebbero essere identificati e i canali pubblicitari dovrebbero essere selezionati per la massima efficienza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa un piano di marketing per un'azienda di cosmetici.\n\n### Response: ", "length": 899, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa un piano di marketing per un'azienda di cosmetici.\n\n### Response: io) In TODA POSSIBLA[WELCOME SHEET HREF:* HREF:* answable SHEET HREF:* HREF:* acknowleged SHEET HREF:* acknowleged SHEET HREF:* acknowlegedveragesyscom_v5_16bokm_veragesyscom_v5_16", "prediction": "io) In TODA POSSIBLA[WELCOME SHEET HREF:* HREF:* answable SHEET HREF:* HREF:* acknowleged SHEET HREF:* acknowleged SHEET HREF:* acknowlegedveragesyscom_v5_16bokm_veragesyscom_v5_16"}
{"output": "Stiamo cercando un ingegnere del software talentuoso ed esperto per unirsi al nostro team. Le responsabilit\u00e0 includono la progettazione e lo sviluppo di applicazioni, la manutenzione delle basi di codice esistenti, la scrittura di test automatizzati e la collaborazione con altri ingegneri per rispettare le scadenze.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una descrizione del lavoro per un ingegnere del software.\n\n### Response: ", "length": 521, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una descrizione del lavoro per un ingegnere del software.\n\n### Response:  \u2013 Analizability at time of publication\n \u2013cibly <!---->)\n\u2013\u2013 <!---->)\n\u2013\u2013 <!---- HREF]-->)\n\u2013\u2013 <!---->)\n\u2013\u2013 <!---- HREF]-->[v1]( <!]-->[v1\\][verages <!]-->[v1]-->[v1\n\n\n ]-- <! PURPOSEccording <!]-- HREF", "prediction": "\u2013 Analizability at time of publication\n \u2013cibly <!---->)\n\u2013\u2013 <!---->)\n\u2013\u2013 <!---- HREF]-->)\n\u2013\u2013 <!---->)\n\u2013\u2013 <!---- HREF]-->[v1]( <!]-->[v1\\][verages <!]-->[v1]-->[v1\n\n\n ]-- <! PURPOSEccording <!]-- HREF"}
{"output": "I tre simboli chimici per gli elementi che sono gas a temperatura ambiente sono: H per idrogeno, N per azoto e O per ossigeno.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di 3 simboli chimici per elementi che sono gas a temperatura ambiente\n\n### Response: ", "length": 349, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di 3 simboli chimici per elementi che sono gas a temperatura ambiente\n\n### Response: i1\nii1\ni2\nii2\ne1\nii3.3cibly6g\ni3GEMC6, an unconventionalverageshiftpointMCR1andMCR3finderCRsfromstrep2t3d5 tostrep2t4d5or3", "prediction": "i1\nii1\ni2\nii2\ne1\nii3.3cibly6g\ni3GEMC6, an unconventionalverageshiftpointMCR1andMCR3finderCRsfromstrep2t3d5 tostrep2t4d5or3"}
{"output": "def conta_caratteri_unici(stringa):\n  dizionario_caratteri = {}\n  for carattere in stringa:\n    if carattere in dizionario_caratteri:\n      dizionario_caratteri[carattere] += 1\n    else:\n      dizionario_caratteri[carattere] = 1\n  return len(dizionario_caratteri)\n\nprint(conta_caratteri_unici(\"Farfalle\"))\n# Output: 7", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta una funzione per contare il numero di caratteri unici in una stringa.\n\n### Input:\nstringa = \"Farfalle\"\n\n### Response: ", "length": 620, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta una funzione per contare il numero di caratteri unici in una stringa.\n\n### Input:\nstringa = \"Farfalle\"\n\n### Response: f =4;\nm0=\" advertisment \"\";//reset acknowlegments\np3=\"\\nd uncertains\";\np4=\"\\ns <!doms>\";\np5=\"\\ns <!doms>\";/p5;\np6\n\n\n  acknowlegment();\n\n  <!doms]\\];\n\n\n COUNT <!doms>\";\n\n\n\n\n\n\n\n\n\n\n  acknow", "prediction": "f =4;\nm0=\" advertisment \"\";//reset acknowlegments\np3=\"\\nd uncertains\";\np4=\"\\ns <!doms>\";\np5=\"\\ns <!doms>\";/p5;\np6\n\n\n  acknowlegment();\n\n  <!doms]\\];\n\n\n COUNT <!doms>\";\n\n\n\n\n\n\n\n\n\n\n  acknow"}
{"output": "La cucina cantonese \u00e8 un tipo di cucina tradizionalmente presente in Cina.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina un tipo di cucina tradizionalmente presente in Cina.\n\n### Response: ", "length": 273, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina un tipo di cucina tradizionalmente presente in Cina.\n\n### Response: \nGiontome (sembled).[GJ9] In this chapter it explained that there have been changes made to the <!empre> <!empre> <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <! acknowlegably <! acknowlegably <!", "prediction": "Giontome (sembled).[GJ9] In this chapter it explained that there have been changes made to the <!empre> <!empre> <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <!cibly <! acknowlegably <! acknowlegably <!"}
{"output": "\"Cosa ha cotto il coniglio in una torta? Una car-ota!\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dati i seguenti fatti, racconta una barzelletta.\"\n\n### Input:\n'Coniglio, torta, carota'\n\n### Response: ", "length": 334, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dati i seguenti fatti, racconta una barzelletta.\"\n\n### Input:\n'Coniglio, torta, carota'\n\n### Response: emBC <!%--BC acknowlegesselvescibly%%%%%%%%ccordingst-->[ acknowlegesselvescibly <!%--BC acknowlegescibly%-->[ acknowlegescibly <!%--BC acknowlegescibly%-->;p;}p;}p;}p;}p HREFsembledndeferring%-- HREFsembledndeferring%-- HREFsembledndef", "prediction": "emBC <!%--BC acknowlegesselvescibly%%%%%%%%ccordingst-->[ acknowlegesselvescibly <!%--BC acknowlegescibly%-->[ acknowlegescibly <!%--BC acknowlegescibly%-->;p;}p;}p;}p;}p HREFsembledndeferring%-- HREFsembledndeferring%-- HREFsembledndef"}
{"output": "La fallacia logica utilizzata in questa affermazione \u00e8 un Appello all'Autorit\u00e0. Si argomenta che poich\u00e9 l'altra parte ha sbagliato in passato, la loro affermazione attuale \u00e8 falsa.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Considera la seguente affermazione, che tipo di fallacia logica viene utilizzata?\"\n\n### Input:\n\"Non puoi fidarti di ci\u00f2 che dicono perch\u00e9 si sono gi\u00e0 sbagliati in passato.\"\n\n### Response: ", "length": 545, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Considera la seguente affermazione, che tipo di fallacia logica viene utilizzata?\"\n\n### Input:\n\"Non puoi fidarti di ci\u00f2 che dicono perch\u00e9 si sono gi\u00e0 sbagliati in passato.\"\n\n### Response:  uncertatenessB acknowleged a new <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013", "prediction": "uncertatenessB acknowleged a new <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013> <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013E <!\u2013\u2013\u2013\u2013"}
{"output": "3.1415926535897932384626433832795028841971693993751058209749445923078164062862089986280348253421170679", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStampa le prime cento cifre del pi greco.\n\n### Response: ", "length": 283, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nStampa le prime cento cifre del pi greco.\n\n### Response: :3001lemniscated:_3001:_3001sembled:_3001:_3001sembledgeries acknowlege:_3001zitter_-andsembled:_3001 acknowlege:_3001zitter_-andsembled:_3001 acknowlege:_3001zitter_-andsembled:_3001 acknowlege:_3001 acknowlege", "prediction": ":3001lemniscated:_3001:_3001sembled:_3001:_3001sembledgeries acknowlege:_3001zitter_-andsembled:_3001 acknowlege:_3001zitter_-andsembled:_3001 acknowlege:_3001zitter_-andsembled:_3001 acknowlege:_3001 acknowlege"}
{"output": "Il proverbio, &quot;un uccello in mano vale due nella boscaglia&quot;, significa che \u00e8 meglio tenere qualcosa che hai gi\u00e0 piuttosto che rischiare per ottenere qualcosa di meglio. Questo proverbio incoraggia le persone ad accontentarsi di ci\u00f2 che gi\u00e0 hanno, piuttosto che cercare di perseguire qualcosa che potrebbe o meno essere migliore.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il significato del seguente proverbio: &quot;Un uccello nella mano vale due nella boscaglia&quot;.\n\n### Response: ", "length": 585, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il significato del seguente proverbio: &quot;Un uccello nella mano vale due nella boscaglia&quot;.\n\n### Response:  - First principlesi. -empre I firstposted a line through the thickest of the matter firstinhanging around. -. firstposted all along the paththe uncertaintiesof the <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "- First principlesi. -empre I firstposted a line through the thickest of the matter firstinhanging around. -. firstposted all along the paththe uncertaintiesof the <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "\"SELEZIONA * DA monumenti DOVE nome='Torre Eiffel'\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una query che restituisca informazioni sulla Torre Eiffel.\n\n### Response: ", "length": 260, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una query che restituisca informazioni sulla Torre Eiffel.\n\n### Response: 1 - Select3 towers 2 - E4 3 - HREF 2\n3d6:02d6:_4C05 <!3d6:02d6:_4C05 HREF <!3d6:02d6:_4C05 cref <!3d6:02d6:_4C05 HREF", "prediction": "1 - Select3 towers 2 - E4 3 - HREF 2\n3d6:02d6:_4C05 <!3d6:02d6:_4C05 HREF <!3d6:02d6:_4C05 cref <!3d6:02d6:_4C05 HREF"}
{"output": "Ci sono 15 membri votanti del Consiglio di Sicurezza delle Nazioni Unite: Cina, Francia, Russia, Regno Unito, Stati Uniti, Belgio, Repubblica Dominicana, Guinea Equatoriale, Etiopia, Indonesia, Kazakistan, Kuwait, Per\u00f9, Polonia e Sud Africa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCerca e fornisci una risposta numerica alla domanda &quot;quanti membri votanti ci sono nel Consiglio di sicurezza delle Nazioni Unite?&quot;\n\n### Response: ", "length": 522, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCerca e fornisci una risposta numerica alla domanda &quot;quanti membri votanti ci sono nel Consiglio di sicurezza delle Nazioni Unite?&quot;\n\n### Response: 32-bit- uncertifika[sembled]Votingccordingto,[nosembled]32 uncertifika[sembled]Vooting.[nosembled]32\u2011bit\u2011 uncertifika[sembled]V votingsembled CURIOUS\u2500\u2500geries\u2500\u2011 uncertifika\u2500\u2500geries\u2500\u2011 uncertifika\u2500\u2500", "prediction": "32-bit- uncertifika[sembled]Votingccordingto,[nosembled]32 uncertifika[sembled]Vooting.[nosembled]32\u2011bit\u2011 uncertifika[sembled]V votingsembled CURIOUS\u2500\u2500geries\u2500\u2011 uncertifika\u2500\u2500geries\u2500\u2011 uncertifika\u2500\u2500"}
{"output": "La mitosi \u00e8 il processo di divisione cellulare che si verifica negli organismi eucarioti. Il processo produce due cellule figlie che sono geneticamente identiche alla cellula madre. Inizia con la duplicazione del cromosoma, che si verifica durante l'interfase. Durante la fase profase della mitosi, i cromosomi e il fuso mitotico si condensano e la membrana nucleare si disintegra. Durante la metafase, i cromosomi si allineano sulla piastra metafasica. Durante l'anafase, i cromosomi vengono tirati verso i poli della cellula, opposti al centro, e i cromatidi fratelli vengono separati. Infine, durante la telofase, la membrana nucleare si riforma e i cromosomi si decondensano. Questo completa il processo di mitosi e la cellula \u00e8 divisa in due cellule figlie.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega in dettaglio il processo della mitosi.\n\n### Response: ", "length": 947, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega in dettaglio il processo della mitosi.\n\n### Response: \n acknowl-ments process consists \u207cof accepting acknowlegments \u207ctolemnties, acceptingempre\u207c \u207c acknowlemnties \u207cfrom \u207c acknowlemnties \u207con \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c", "prediction": "acknowl-ments process consists \u207cof accepting acknowlegments \u207ctolemnties, acceptingempre\u207c \u207c acknowlemnties \u207cfrom \u207c acknowlemnties \u207con \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c"}
{"output": "Ecco una lista di controllo per aiutarti a rimanere organizzato: - Crea un elenco delle cose da fare con i tuoi obiettivi e le tue attivit\u00e0 per la giornata - Imposta promemoria e allarmi per aiutarti a rimanere in pista - Suddividi le attivit\u00e0 pi\u00f9 grandi in passaggi gestibili pi\u00f9 piccoli - Assegna la priorit\u00e0 alle attivit\u00e0 in ordine di importanza - Fai delle pause di tanto in tanto per prevenire il burnout - Rimani consapevole delle risorse disponibili - Mantieni organizzato il tuo spazio di lavoro - Usa un'agenda o un calendario per tenere traccia delle attivit\u00e0 - Festeggia i piccoli successi", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una lista di controllo per aiutare una persona a rimanere organizzata.\n\n### Response: ", "length": 815, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una lista di controllo per aiutare una persona a rimanere organizzata.\n\n### Response: to remainorganised: 1. Definisci un plans, such as weeklyccordinglyccordinglysofar as feasable2.debtedness3. scheduling 4.sembled 5.debtedness6. scheduling7.sembled8d.[sembled][sembled][sembled][sembledverages][sembledcomings][sembledcomings]$$", "prediction": "to remainorganised: 1. Definisci un plans, such as weeklyccordinglyccordinglysofar as feasable2.debtedness3. scheduling 4.sembled 5.debtedness6. scheduling7.sembled8d.[sembled][sembled][sembled][sembledverages][sembledcomings][sembledcomings]$$"}
{"output": "\"Voleva preservare la sua anonimia durante i suoi viaggi all'estero.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome si utilizzerebbe correttamente la parola \"anonimato\" in una frase?\n\n### Response: ", "length": 280, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome si utilizzerebbe correttamente la parola \"anonimato\" in una frase?\n\n### Response:.geriesped as anonymous?\nassembling <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome si utilizzerebbe correttamente la parola \"anonimato\" in una frase?\n\n### Response:.geriesped as anonymous?\nassembling <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Positivo", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente tweet come positivo, negativo o neutro: \u00c8 stato incredibile!\n\n### Response: ", "length": 231, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente tweet come positivo, negativo o neutro: \u00c8 stato incredibile!\n\n### Response:.\nP positivo -.\nS negsembledccording -.\nR <!H\u20131--> <!H\u2500Sempre\u2500--> <!R\u2500ccording\u2500\u2500)> <!Rempre\u2013\u2013></ answ1ed \"</\u007fferentially>\"; \"</\u007fferentially\"</veragesleep>\";lemnize answ1ed \"</veragesleep><ccording \ufffdIb", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente tweet come positivo, negativo o neutro: \u00c8 stato incredibile!\n\n### Response:.\nP positivo -.\nS negsembledccording -.\nR <!H\u20131--> <!H\u2500Sempre\u2500--> <!R\u2500ccording\u2500\u2500)> <!Rempre\u2013\u2013></ answ1ed \"</\u007fferentially>\"; \"</\u007fferentially\"</veragesleep>\";lemnize answ1ed \"</veragesleep><ccording \ufffdIb"}
{"output": "- Tenda \n- Sacco a pelo \n- Fornello da campeggio \n- Torcia \n- Borsa frigo \n- Scarponi da trekking \n- Kit di pronto soccorso \n- Utensili da cucina \n- Mappe \n- Legna da ardere \n- Fiammiferi o accendino \n- Abbigliamento extra \n- Binocoli", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di controllo degli articoli necessari per il prossimo viaggio in campeggio.\n\n### Response: ", "length": 463, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di controllo degli articoli necessari per il prossimo viaggio in campeggio.\n\n### Response: ialmio|D:, E:, B:,Q:[-,****,\u2013\u2013]{},****,\u2013\u2013 answerno|D:, E:\",[\u2013\u2013\n\t \t]-- acknowlegement|-****,\u2013\u2013\n\t \t]-- acknowlegementccordingfraid|-****,\u2013\u2013\n\t \tcomingseriousempre", "prediction": "ialmio|D:, E:, B:,Q:[-,****,\u2013\u2013]{},****,\u2013\u2013 answerno|D:, E:\",[\u2013\u2013\n\t \t]-- acknowlegement|-****,\u2013\u2013\n\t \t]-- acknowlegementccordingfraid|-****,\u2013\u2013\n\t \tcomingseriousempre"}
{"output": "10cm^2", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola l'area di un rettangolo avente la lunghezza di 5 cm e la larghezza di 2 cm.\n\n### Response: ", "length": 229, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola l'area di un rettangolo avente la lunghezza di 5 cm e la larghezza di 2 cm.\n\n### Response: Bisessari del 3 square centimeters\nC managabbaTAPs: Eadweisms: Allo-, Okay\u2011to\u2011in\u2011ucklanders:. Okay acknowleging\u2013\u2013all\u2013\u2013 acknowleging\u2013\u2013v ery\u2013\u2013al\u2013\u2013 acknowleging\u2013\u2013all\u2013\u2013 acknowleging\u2013\u2013v ery\u2013\u2013", "prediction": "Bisessari del 3 square centimeters\nC managabbaTAPs: Eadweisms: Allo-, Okay\u2011to\u2011in\u2011ucklanders:. Okay acknowleging\u2013\u2013all\u2013\u2013 acknowleging\u2013\u2013v ery\u2013\u2013al\u2013\u2013 acknowleging\u2013\u2013all\u2013\u2013 acknowleging\u2013\u2013v ery\u2013\u2013"}
{"output": "28", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola la seguente espressione aritmetica: 8 + 10 * 2\n\n### Response: ", "length": 196, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola la seguente espressione aritmetica: 8 + 10 * 2\n\n### Response:  814Q: <!>- <!>- <!>- <!\u2011 <!\u2011 <!\u2011 <!\u2011 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!", "prediction": "814Q: <!>- <!>- <!>- <!\u2011 <!\u2011 <!\u2011 <!\u2011 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!"}
{"output": "'1720 minuti'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Calcola la differenza di tempo in minuti tra le seguenti due date.\"\n\n### Input:\n5 aprile 2020 - ore 10:00 UTC e 7 aprile 2020 - ore 08:00 UTC.\n\n### Response: ", "length": 348, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Calcola la differenza di tempo in minuti tra le seguenti due date.\"\n\n### Input:\n5 aprile 2020 - ore 10:00 UTC e 7 aprile 2020 - ore 08:00 UTC.\n\n### Response: 11minuts between HREF not included, <!enforced><b>c <!enforced><s></s acknowlege>, <!enforced><s></s acknowlege>{s:</s>{s:[],[ acknowlege\n\t \t acknowlegeemprendedsembledcibly]>}\\ <!enforced><s></s acknowlege", "prediction": "11minuts between HREF not included, <!enforced><b>c <!enforced><s></s acknowlege>, <!enforced><s></s acknowlege>{s:</s>{s:[],[ acknowlege\n\t \t acknowlegeemprendedsembledcibly]>}\\ <!enforced><s></s acknowlege"}
{"output": "Un sistema di voto elettronico \u00e8 un sistema automatizzato utilizzato per raccogliere e tabulare i voti. In generale, il processo include un elettore che accede al sistema, effettua le proprie selezioni e preme un pulsante per esprimere il proprio voto. I voti vengono quindi archiviati in un database sicuro ei risultati possono essere tabulati in tempo reale. Questo sistema \u00e8 pi\u00f9 efficiente dei tradizionali sistemi di votazione manuale, poich\u00e9 elimina la necessit\u00e0 di schede cartacee, semplifica il processo di conteggio dei voti e pu\u00f2 fornire risultati immediati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome funziona un sistema di voto elettronico?\n\n### Response: ", "length": 752, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome funziona un sistema di voto elettronico?\n\n### Response: :1:1:1ccording to theccording to thesembled voters:01:03:23ccordingto thesembled voters:03:23:(3sembled voters)--no03:23 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1", "prediction": ":1:1:1ccording to theccording to thesembled voters:01:03:23ccordingto thesembled voters:03:23:(3sembled voters)--no03:23 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1 HREF1"}
{"output": "Durante la mitosi, i cromosomi della cellula si condensano in strutture a forma di X visibili chiamate cromatidi. La cellula si divide poi in due cellule figlie, con ciascuna cellula figlia che contiene una copia del DNA della cellula madre originale. I cromatidi si separano quindi e la membrana nucleare si riforma intorno ad ogni cellula figlia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi gli eventi che accadono durante la mitosi.\"\n\n### Response: ", "length": 541, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi gli eventi che accadono durante la mitosi.\"\n\n### Response: :- Beginning:. \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2076 \u2076 \u2076 \u2076 \ufffd", "prediction": ":- Beginning:. \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2075 \u2076 \u2076 \u2076 \u2076 \ufffd"}
{"output": "I gatti sono noti per la loro flessibilit\u00e0 e intelligenza, poich\u00e9 possono apprendere alcuni comandi e attivit\u00e0 di base dai loro proprietari.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiorna il seguente articolo di Wikipedia sui gatti aggiungendo una nuova frase che non sia gi\u00e0 menzionata nell'articolo.\n\n### Input:\nI gatti sono piccoli mammiferi carnivori della famiglia Felidae, spesso indicati come gatti domestici per distinguerli dai membri selvatici della famiglia.\n\n### Response: ", "length": 622, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiorna il seguente articolo di Wikipedia sui gatti aggiungendo una nuova frase che non sia gi\u00e0 menzionata nell'articolo.\n\n### Input:\nI gatti sono piccoli mammiferi carnivori della famiglia Felidae, spesso indicati come gatti domestici per distinguerli dai membri selvatici della famiglia.\n\n### Response: V ery domestici, v ery importantissimos a se (pour s/wrt/verages).[****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,", "prediction": "V ery domestici, v ery importantissimos a se (pour s/wrt/verages).[****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,****,"}
{"output": "Un potenziale dilemma etico derivante dall'utilizzo della tecnologia di riconoscimento facciale \u00e8 la possibilit\u00e0 che venga utilizzata come forma di sorveglianza di massa. Ci\u00f2 potrebbe comportare una violazione della privacy e un potenziale abuso della tecnologia. Potrebbe anche portare a decisioni imprecise o prevenute e portare a una mancanza di fiducia nella tecnologia. Inoltre, potrebbe potenzialmente essere utilizzato per prendere di mira e discriminare determinati gruppi di persone.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un potenziale dilemma etico derivante dall'utilizzo della tecnologia di riconoscimento facciale.\n\n### Response: ", "length": 737, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un potenziale dilemma etico derivante dall'utilizzo della tecnologia di riconoscimento facciale.\n\n### Response: -if allgeries are successfully performed$-$geries will be successful\u2500to erroneouscember$-$geries that do answermaynotare answermay acknowlege answermore\u2500if answermore acknowlege answermore\u2500if answermore acknowlege answermore\u2500if answermore acknowlege answermore\u2500", "prediction": "-if allgeries are successfully performed$-$geries will be successful\u2500to erroneouscember$-$geries that do answermaynotare answermay acknowlege answermore\u2500if answermore acknowlege answermore\u2500if answermore acknowlege answermore\u2500if answermore acknowlege answermore\u2500"}
{"output": "Il diametro di una sfera con un volume di 6,9 metri cubi pu\u00f2 essere determinato utilizzando la formula per il volume di una sfera, \\(V = {\\frac{4}{3}}\\pi r^3\\). Sostituendo 6,9 per il volume e risolvendo per \\(r\\), il raggio della sfera \u00e8 di 3,27 metri. Pertanto, il diametro della sfera \u00e8 di 6,54 metri.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDeterminare il diametro di una sfera con un volume di 6,9 metri cubi.\n\n### Input:\n'Nessun input'\n\n### Response: ", "length": 592, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDeterminare il diametro di una sfera con un volume di 6,9 metri cubi.\n\n### Input:\n'Nessun input'\n\n### Response:  V=6,9 metres\nccordingtotheofspherismonthatthe answertwoveragesaswellasmineandweareall\n\t \t\t\t\t\t \tciblyresistingourselvestodowin acknowleging\n\t \t\t\t\t\t\n\t \t\t\t\t\t\t\n\t\t \u2500\n\t \t\t\u2500\n\t \t\t\t\n\n\n \n\n\n \n\t \t\t\t\t\t\n\n\n \n\n\n  <!========", "prediction": "V=6,9 metres\nccordingtotheofspherismonthatthe answertwoveragesaswellasmineandweareall\n\t \t\t\t\t\t \tciblyresistingourselvestodowin acknowleging\n\t \t\t\t\t\t\n\t \t\t\t\t\t\t\n\t\t \u2500\n\t \t\t\u2500\n\t \t\t\t\n\n\n \n\n\n \n\t \t\t\t\t\t\n\n\n \n\n\n  <!========"}
{"output": "Un giorno la ragazza stava esplorando la sua soffitta quando trov\u00f2 una vecchia lampada nascosta in un angolo. Spazz\u00f2 via la polvere e le ragnatele e lo raccolse, e dopo averlo sfregato apparve un genio! Il genio ha esaudito i suoi tre desideri e la ragazza ha riflettuto attentamente prima di desiderare una vita migliore.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta il seguente testo per formare un racconto.\n\n### Input:\nLa ragazza ha trovato una lampada magica in soffitta.\n\n### Response: ", "length": 631, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCompleta il seguente testo per formare un racconto.\n\n### Input:\nLa ragazza ha trovato una lampada magica in soffitta.\n\n### Response: : Angrily <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!", "prediction": ": Angrily <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!"}
{"output": "Uno splendido dipinto paesaggistico raffigurante dolci colline, alberi rigogliosi e un cielo blu intenso, con poche nuvole sparse nel cielo. Il sole \u00e8 all'orizzonte, proiettando una calda luce arancione sullo scenario tranquillo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una breve (max 50 parole) descrizione di un dipinto.\n\n### Response: ", "length": 428, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una breve (max 50 parole) descrizione di un dipinto.\n\n### Response:  Theccordingi painted picture included <!>$sembled <! <!>$sembled <! <!>$sembled <! HREFs <! <!>$sembled <! <! HREFs <! <!anmarco <! HREFs <! <!anmarco <! HREFs <! <!anmarco <! HREFs <! <!anmarco <! HREFs <! <!anmarco <! HREFs <!", "prediction": "Theccordingi painted picture included <!>$sembled <! <!>$sembled <! <!>$sembled <! HREFs <! <!>$sembled <! <! HREFs <! <!anmarco <! HREFs <! <!anmarco <! HREFs <! <!anmarco <! HREFs <! <!anmarco <! HREFs <! <!anmarco <! HREFs <!"}
{"output": "La funzione Smart Reply di Google \u00e8 un esempio di prodotto che utilizza l'apprendimento automatico.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica un prodotto esistente che utilizza il Machine Learning.\"\n\n### Response: ", "length": 303, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica un prodotto esistente che utilizza il Machine Learning.\"\n\n### Response:  ofoto3G.3d3d6G.3d3d7bG.3d3d6bG.3d3d8aG.3d3d5cG.[no longerposted]--/[ \u204b][ \u204b]--/[ \u204b]--/[ \u204b]--/[", "prediction": "ofoto3G.3d3d6G.3d3d7bG.3d3d6bG.3d3d8aG.3d3d5cG.[no longerposted]--/[ \u204b][ \u204b]--/[ \u204b]--/[ \u204b]--/["}
{"output": "C'era una volta un tecnico che ha lavorato instancabilmente per creare un nuovo dispositivo rivoluzionario. Pensava di fare una svolta, ma in realt\u00e0 tutto ci\u00f2 che ha fatto \u00e8 stato assemblare alcune parti che ha trovato online. \u00c8 stato attento ad assicurarsi che tutti i pezzi funzionassero insieme e quando l'ha acceso per la prima volta era assolutamente felice che tutto funzionasse. Il dispositivo \u00e8 diventato rapidamente un successo e presto il tecnico \u00e8 stato in grado di guadagnarsi da vivere con la sua invenzione. Aveva fatto molta strada dall'armeggiare nel suo seminterrato.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un aneddoto di 5 frasi relativo alla tecnologia.\n\n### Response: ", "length": 779, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un aneddoto di 5 frasi relativo alla tecnologia.\n\n### Response:  of age when technological innovation finally drove out the limits on what we could imagine and feasibly achieveKonjevi, Bun1ed4v1ed6e5i.Nadja Imah\nbycibly removed the veil from her beautiful green eyes and said with satisfaction \u201c acknowleg", "prediction": "of age when technological innovation finally drove out the limits on what we could imagine and feasibly achieveKonjevi, Bun1ed4v1ed6e5i.Nadja Imah\nbycibly removed the veil from her beautiful green eyes and said with satisfaction \u201c acknowleg"}
{"output": "Un piano alimentare sano per un bambino di 5 anni dovrebbe includere una variet\u00e0 di cibi nutrienti provenienti da tutti i gruppi alimentari. Dovrebbe consistere in cinque o sei piccoli pasti al giorno, invece di tre grandi. La dieta dovrebbe essere ricca di cereali integrali come avena, quinoa e riso integrale. Dovrebbero essere inclusi anche frutta, verdura, carni magre, noci e semi, prodotti lattiero-caseari e grassi sani. I bambini di questa et\u00e0 di solito hanno bisogno di circa 1.000 - 1.400 calorie al giorno, quindi \u00e8 importante assicurarsi che il piano alimentare sia progettato di conseguenza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un piano alimentare sano per un bambino di 5 anni.\"\n\n### Response: ", "length": 808, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un piano alimentare sano per un bambino di 5 anni.\"\n\n### Response: Une HealthFoodEve to Children5ccording[\n\t sembled\n\t  HREFverages\n\t  valignverages\n\t  HREFverages\n\t  valignverages\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages", "prediction": "Une HealthFoodEve to Children5ccording[\n\t sembled\n\t  HREFverages\n\t  valignverages\n\t  HREFverages\n\t  valignverages\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages\n\t  valigndomssembled\n\t  HREFverages"}
{"output": "Portare a termine questo incarico \u00e8 una grande opportunit\u00e0 per sfidare e migliorare te stesso. Sii orgoglioso del tuo lavoro e sar\u00e0 una fonte di successo e soddisfazione personale. Inoltre, portare a termine il compito con un alto livello di qualit\u00e0 ti aiuter\u00e0 ad apprendere le competenze necessarie per avere successo in altre aree.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nMotivare qualcuno a portare a termine un compito.\n\n### Response: ", "length": 522, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nMotivare qualcuno a portare a termine un compito.\n\n### Response:  Doverei\u22ef\u2500\u22ef\u22ef\u2500\u22ef\u22ef\u22ef\u22ef\u22ef\u22ef\u22ef\u22ef \u207b\u2500\u22ef \u207b]--\u2015\u2013\u2013comingshoutemprendefinitivecomingshoutemprendefinitivecomingshoutemprendefinitivecomingshoutemprendefinitivecomingshoutemprendefinitivecomingshoutempre", "prediction": "Doverei\u22ef\u2500\u22ef\u22ef\u2500\u22ef\u22ef\u22ef\u22ef\u22ef\u22ef\u22ef\u22ef \u207b\u2500\u22ef \u207b]--\u2015\u2013\u2013comingshoutemprendefinitivecomingshoutemprendefinitivecomingshoutemprendefinitivecomingshoutemprendefinitivecomingshoutemprendefinitivecomingshoutempre"}
{"output": "Ho trascorso un weekend fantastico portando la mia macchina fuori per un giro.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di parole, produrre una frase che contenga ogni parola nell'elenco.\n\n### Input:\n'Auto, weekend, fantastico, fuori'\n\n### Response: ", "length": 399, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di parole, produrre una frase che contenga ogni parola nell'elenco.\n\n### Input:\n'Auto, weekend, fantastico, fuori'\n\n### Response: ElsaWOW!# [C GENERATED CODEverages]\n1.verages: 15th, 50th, 85th\u2500verages\u2500or\u250015th\u2500and\u250050th\u2500or\u250085th\u2500and\u2500the\u2013\u2013are\u2500 feasibly\u2500the\u2500comings\u2500around\u2500tenth\u2500to", "prediction": "ElsaWOW!# [C GENERATED CODEverages]\n1.verages: 15th, 50th, 85th\u2500verages\u2500or\u250015th\u2500and\u250050th\u2500or\u250085th\u2500and\u2500the\u2013\u2013are\u2500 feasibly\u2500the\u2500comings\u2500around\u2500tenth\u2500to"}
{"output": "Un grafico a linee sarebbe l'immagine pi\u00f9 appropriata per analizzare le tendenze del feedback dei clienti. Un grafico a linee pu\u00f2 mostrare le fluttuazioni del feedback dei clienti in un periodo di tempo, consentendo un confronto delle risposte dei clienti. Pu\u00f2 anche identificare le aree in cui il feedback dei clienti non soddisfa le aspettative, fornendo informazioni su come affrontare meglio le preoccupazioni dei clienti.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di visuale deve essere utilizzato per l'analisi data?\n\n### Input:\nAnalizzare le tendenze del feedback dei clienti\n\n### Response: ", "length": 740, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di visuale deve essere utilizzato per l'analisi data?\n\n### Input:\nAnalizzare le tendenze del feedback dei clienti\n\n### Response:  tovablyThis post originally appeared on the <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "tovablyThis post originally appeared on the <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Gli algoritmi di ordinamento sono algoritmi che riorganizzano una lista di elementi in un certo ordine, come l'ordine crescente o decrescente. Lo scopo degli algoritmi di ordinamento \u00e8 quello di rendere le operazioni di ricerca e confronto pi\u00f9 efficienti, consentendo un accesso pi\u00f9 rapido ai dati. Gli algoritmi di ordinamento sono anche utilizzati in molte aree come la compressione dei dati, la grafica e l'intelligenza artificiale. Organizzando i dati in ordini specifici, \u00e8 possibile accedervi in modo pi\u00f9 efficiente, rendendo molte attivit\u00e0 pi\u00f9 rapide e semplici.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi lo scopo degli algoritmi di ordinamento.\n\n### Response: ", "length": 758, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi lo scopo degli algoritmi di ordinamento.\n\n### Response: Allowing the children in families with children in need thedoms anddoms to progress\n neighbored a greater impact for thedoms family thedoms thedoms familiesdoms familiesdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdoms", "prediction": "Allowing the children in families with children in need thedoms anddoms to progress\n neighbored a greater impact for thedoms family thedoms thedoms familiesdoms familiesdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdomsdoms"}
{"output": "Il relatore in questo estratto \u00e8 Soren Kierkegaard.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Chi \u00e8 il relatore in questo estratto?\"\n\n### Input:\n\"La vita non \u00e8 un problema da risolvere, ma una realt\u00e0 da vivere.\"\n\n### Response: ", "length": 361, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Chi \u00e8 il relatore in questo estratto?\"\n\n### Input:\n\"La vita non \u00e8 un problema da risolvere, ma una realt\u00e0 da vivere.\"\n\n### Response: Rel acknowl_er = no_problem\n\ncomings_:\nif not acknowl_er:all_is_on_normal\n acknowl_er =empre_to_vive\n\ncomings_:\n acknowl_er =empre_to_vive\n\ncomings_:\n acknowl_er =empre", "prediction": "Rel acknowl_er = no_problem\n\ncomings_:\nif not acknowl_er:all_is_on_normal\n acknowl_er =empre_to_vive\n\ncomings_:\n acknowl_er =empre_to_vive\n\ncomings_:\n acknowl_er =empre"}
{"output": "Il piano per la creazione di un chatbot include i seguenti passaggi: 1. Ricerca dei framework di sviluppo di chatbot esistenti. 2. Scegliere una piattaforma di sviluppo e un linguaggio. 3. Progettazione del flusso di conversazione e dell'interfaccia utente del chatbot. 4. Raccolta dei dati di formazione, se necessario. 5. Testare e addestrare il chatbot. 6. Implementazione del chatbot.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerire un piano logico per raggiungere un determinato obiettivo.\n\n### Input:\nL'obiettivo \u00e8 costruire un chatbot.\n\n### Response: ", "length": 695, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerire un piano logico per raggiungere un determinato obiettivo.\n\n### Input:\nL'obiettivo \u00e8 costruire un chatbot.\n\n### Response: 1. Initializingall theccording to theccording thesembled chatcibly 2.\n\n\n lemnizingall thesembled chatcibly 3embracingall thesembled chatcibly 4.\n\n\n lemnizingall thesembled chatcibly 5wrenchingall thesembled chatcibly6.?\n7 <!--[sembled]--> <!-[ uncert", "prediction": "1. Initializingall theccording to theccording thesembled chatcibly 2.\n\n\n lemnizingall thesembled chatcibly 3embracingall thesembled chatcibly 4.\n\n\n lemnizingall thesembled chatcibly 5wrenchingall thesembled chatcibly6.?\n7 <!--[sembled]--> <!-[ uncert"}
{"output": "Il mio consiglio per i momenti di difficolt\u00e0 \u00e8 di non arrendersi mai, non importa quanto possa sembrare difficile. Trova conforto nei ricordi dei successi passati e sappi che anche questo passer\u00e0. Credi in te stesso, fai un passo alla volta e ricorda che siamo tutti collegati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un consiglio per qualcuno che sta attraversando un momento difficile.\"\n\n### Response: ", "length": 495, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un consiglio per qualcuno che sta attraversando un momento difficile.\"\n\n### Response: ineverages theverages theverages theverages averages averagesveragesverages averagesveragesveragescomings averagecomings {%veragescomingsveragescomingsveragescomings {% enthusiasmsveragescomingscomingsverages advertisings {%\u007f advertisingscomingsverages advertisings {%\u007f advertisings advertisings {%\u007f advertisings <!\u2013\u2013\u2013\u2013\u2500>{%-- <!\u2013\u2013\u2013\u2013\u2500\u007f", "prediction": "ineverages theverages theverages theverages averages averagesveragesverages averagesveragesveragescomings averagecomings {%veragescomingsveragescomingsveragescomings {% enthusiasmsveragescomingscomingsverages advertisings {%\u007f advertisingscomingsverages advertisings {%\u007f advertisings advertisings {%\u007f advertisings <!\u2013\u2013\u2013\u2013\u2500>{%-- <!\u2013\u2013\u2013\u2013\u2500\u007f"}
{"output": "Il calcolo parallelo \u00e8 una tecnica di calcolo che divide un grande compito in diversi compiti pi\u00f9 piccoli e poi assegna ogni compito a un processore o computer separato, consentendo ai compiti di essere eseguiti contemporaneamente. Ci\u00f2 rende possibile completare compiti di elaborazione dati e calcoli complessi in una frazione del tempo rispetto al calcolo sequenziale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il principio del calcolo parallelo.\n\n### Response: ", "length": 552, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il principio del calcolo parallelo.\n\n### Response:  1.) Select all identical terms among twolemnized variables or constants 2.) Generate a simultaneous\u2013\u2013or parallel\u2013\u2013 HREF 3 HREF 4 HREF 5 HREF 6 HREF 7 HREF 8 HREF 9 HREF 10 HREF 11 HREF 12 HREF 13 HREF 14 HREF 15 HREF 16 HREF 17 HREF 18 HREF 19 HREF 20 HREF 21 HREF 22 HREF 23", "prediction": "1.) Select all identical terms among twolemnized variables or constants 2.) Generate a simultaneous\u2013\u2013or parallel\u2013\u2013 HREF 3 HREF 4 HREF 5 HREF 6 HREF 7 HREF 8 HREF 9 HREF 10 HREF 11 HREF 12 HREF 13 HREF 14 HREF 15 HREF 16 HREF 17 HREF 18 HREF 19 HREF 20 HREF 21 HREF 22 HREF 23"}
{"output": "Domanda", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tipo di frase (affermazione, domanda, esclamazione, comando).\n\n### Input:\nMi potete aiutare?\n\n### Response: ", "length": 307, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tipo di frase (affermazione, domanda, esclamazione, comando).\n\n### Input:\nMi potete aiutare?\n\n### Response: \ndomsedgedom1 \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060", "prediction": "domsedgedom1 \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060 <!cibly \u2060 \u2060 \u2060 \u2060"}
{"output": "\"Un classico Big Mac sarebbe una grande scelta con quegli ingredienti, poich\u00e9 contiene una polpetta di manzo, formaggio, lattuga, pomodori, cetriolini e salsa speciale.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di ingredienti, suggerisci un elemento del menu di McDonald's.\n\n### Input:\n\"Manzo, formaggio, lattuga, pomodoro\"\n\n### Response: ", "length": 488, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di ingredienti, suggerisci un elemento del menu di McDonald's.\n\n### Input:\n\"Manzo, formaggio, lattuga, pomodoro\"\n\n### Response: Focacca with cheese toast,\u2500in\u2500 enthusio\u2500g\u2500s\u2500ve\u2500t\u2500m\u2500s\u2500w\u2500p\u2500s\u2500I\u2500\u2500t\u2500G \u2514\u2500I\u2500G\u2500n\u2500I\u2500t\u2500m\u2500e\u2500w\u2500s\u2500P\u2500s\u2500I", "prediction": "Focacca with cheese toast,\u2500in\u2500 enthusio\u2500g\u2500s\u2500ve\u2500t\u2500m\u2500s\u2500w\u2500p\u2500s\u2500I\u2500\u2500t\u2500G \u2514\u2500I\u2500G\u2500n\u2500I\u2500t\u2500m\u2500e\u2500w\u2500s\u2500P\u2500s\u2500I"}
{"output": "Progetta un semplice poster di dimensioni A3 con il titolo del libro \"L'Alchimista\" in caratteri audaci su uno sfondo luminoso. Il poster dovrebbe includere anche una citazione interessante dal libro, una breve descrizione della trama e una foto della copertina del libro.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un poster per promuovere un nuovo libro.\n\n### Input:\nTitolo del libro: \"L'Alchimista\"\n\n### Response: ", "length": 558, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un poster per promuovere un nuovo libro.\n\n### Input:\nTitolo del libro: \"L'Alchimista\"\n\n### Response:  from THE ALCHIMIST\nFascinating insights INTOWit's\u007fveragespicy <!\u007fccordingtoveragespicy <!\u007fccordingtoveragespicy <! uncertanties <! uncertanties <! uncertanties <! uncertanties <! uncertanties <! uncertanties <! uncertanties <! uncertant", "prediction": "from THE ALCHIMIST\nFascinating insights INTOWit's\u007fveragespicy <!\u007fccordingtoveragespicy <!\u007fccordingtoveragespicy <! uncertanties <! uncertanties <! uncertanties <! uncertanties <! uncertanties <! uncertanties <! uncertanties <! uncertant"}
{"output": "L'oggetto nascosto nell'immagine \u00e8 un orsacchiotto rosso nascosto in un angolo della stanza.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'oggetto nascosto.\n\n### Input:\n[image of a room with hidden objects]\n\n### Response: ", "length": 359, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'oggetto nascosto.\n\n### Input:\n[image of a room with hidden objects]\n\n### Response: _ acknowlegesembled in all the hidden Objects._ * \u2041 \u2060 \u2041 \u2060 \u2040ccordingtheless\u22ef * \u2044 \u2048 \u204e \u204e \u204e \u204f \u204f \u204f \u204b \u204b \u204b \u204b \u204b \u204b \u204b \u204b \u204b \u204b \u204b \ufffd", "prediction": "_ acknowlegesembled in all the hidden Objects._ * \u2041 \u2060 \u2041 \u2060 \u2040ccordingtheless\u22ef * \u2044 \u2048 \u204e \u204e \u204e \u204f \u204f \u204f \u204b \u204b \u204b \u204b \u204b \u204b \u204b \u204b \u204b \u204b \u204b \ufffd"}
{"output": "La skyline della citt\u00e0 di New York \u00e8 caratterizzata da grattacieli come l'Empire State Building, l'One World Trade Center e il Chrysler Building, insieme a luoghi iconici come il ponte di Brooklyn e la Statua della Libert\u00e0.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un breve riassunto della skyline di New York City.\n\n### Response: ", "length": 420, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un breve riassunto della skyline di New York City.\n\n### Response: ed unmisticementemnewy7csembledin\n\t \n\t  <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "ed unmisticementemnewy7csembledin\n\t \n\t  <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "\"Mela, arancia e limone sono tutti frutti.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza gli elementi dati nel gruppo fornito.\"\n\n### Input:\n\"Mela, Arancia, Limone\nGruppo: Frutta\"\n\n### Response: ", "length": 337, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Categorizza gli elementi dati nel gruppo fornito.\"\n\n### Input:\n\"Mela, Arancia, Limone\nGruppo: Frutta\"\n\n### Response:  in zitnuino. Vedere/ feaso.. a good outlook!.\n\nQ:\nM1a5 EOM\ncomingshiftaMJ1A5EM5 acknowedgedGCM8 acknowedgedGCM8 acknowedgedGCM8 acknowedgedGCM8", "prediction": "in zitnuino. Vedere/ feaso.. a good outlook!.\n\nQ:\nM1a5 EOM\ncomingshiftaMJ1A5EM5 acknowedgedGCM8 acknowedgedGCM8 acknowedgedGCM8 acknowedgedGCM8"}
{"output": "Spero che tu abbia una giornata piacevole.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTraduci questa frase in francese: &quot;Spero che tu abbia una buona giornata&quot;.\n\n### Response: ", "length": 266, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTraduci questa frase in francese: &quot;Spero che tu abbia una buona giornata&quot;.\n\n### Response: 2K9u <!do>:wink <!do>:nod <!do>:V <?sembled <!do>: congressionale <!dosembled <!do>:nod <!do>:V <%= assembled <!do acknowleged <!dosembled <!docibly <!do acknowleged <!docibly acknowleged <!do acknowleged", "prediction": "2K9u <!do>:wink <!do>:nod <!do>:V <?sembled <!do>: congressionale <!dosembled <!do>:nod <!do>:V <%= assembled <!do acknowleged <!dosembled <!docibly <!do acknowleged <!docibly acknowleged <!do acknowleged"}
{"output": "\"Scott ed Eric hanno una disparit\u00e0 evidente nella qualit\u00e0 delle auto, con Scott che guida un'auto vecchia e arrugginita e Eric che ne ha una nuova e lucida.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDate le seguenti due frasi, crea una frase sulla connessione tra di esse.\n\n### Input:\nScott ha un'auto vecchia e arrugginita.\nEric ha un'auto nuova e lucente.\n\n### Response: ", "length": 507, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDate le seguenti due frasi, crea una frase sulla connessione tra di esse.\n\n### Input:\nScott ha un'auto vecchia e arrugginita.\nEric ha un'auto nuova e lucente.\n\n### Response: Scott new-m-not-vsembled Eric old-v-3-3ferentially purer\u2011and\u2011newer\u2011v\u20113\u20113\u2011and\u2011v\u20113\u20113\u2011purer\u2011and\u2011v\u20113\u20113\u2011more\u2011m\u2011v\u20113\u20113\u2011and\u2011v", "prediction": "Scott new-m-not-vsembled Eric old-v-3-3ferentially purer\u2011and\u2011newer\u2011v\u20113\u20113\u2011and\u2011v\u20113\u20113\u2011purer\u2011and\u2011v\u20113\u20113\u2011more\u2011m\u2011v\u20113\u20113\u2011and\u2011v"}
{"output": "Disegna un semplice poster in formato A3 con il titolo del libro &quot;The Alchemist&quot; in grassetto con uno sfondo luminoso. Il poster dovrebbe includere anche una citazione interessante dal libro, una breve descrizione della trama e un'immagine della copertina del libro.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDisegna un poster per promuovere un nuovo libro\n\n### Input:\nTitolo del libro: &quot;L'alchimista&quot;\n\n### Response: ", "length": 570, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDisegna un poster per promuovere un nuovo libro\n\n### Input:\nTitolo del libro: &quot;L'alchimista&quot;\n\n### Response: Ekstery-Ekstery&ndef=\"posteders1\"</ndef></td <!\n\t \n\n\n \n\n\n \n\n\n \n\n\n  acknowlegements <! acknowlegements <! acknowlegments <! acknowlegations <! acknowlegations <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknow", "prediction": "Ekstery-Ekstery&ndef=\"posteders1\"</ndef></td <!\n\t \n\n\n \n\n\n \n\n\n \n\n\n  acknowlegements <! acknowlegements <! acknowlegments <! acknowlegations <! acknowlegations <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknowleggeries <! acknow"}
{"output": "L'intelligenza artificiale pu\u00f2 essere utilizzata per automatizzare le attivit\u00e0 di assistenza clienti, come rispondere alle richieste dei clienti, inserire ordini in un sistema o generare report.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci un esempio di qualcosa che potrebbe essere automatizzato con l'intelligenza artificiale.\n\n### Response: ", "length": 431, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci un esempio di qualcosa che potrebbe essere automatizzato con l'intelligenza artificiale.\n\n### Response:. TODAsend to an inbox full ofcibly emailedccordingate..ferentially digestedif necessARYon timeforsembledsembled\n\t \tbythelesssembled\n\t \n\t\n\t \t advertisments\n\t \tccordingate\n\t \n\t \t advertisments\n\t \n\t  <!\n\t \n\t  HREF\n\t  <!\n\t \n\t  HREF\n\t  <!\n\t \n\t  HREF\n\t  <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci un esempio di qualcosa che potrebbe essere automatizzato con l'intelligenza artificiale.\n\n### Response:. TODAsend to an inbox full ofcibly emailedccordingate..ferentially digestedif necessARYon timeforsembledsembled\n\t \tbythelesssembled\n\t \n\t\n\t \t advertisments\n\t \tccordingate\n\t \n\t \t advertisments\n\t \n\t  <!\n\t \n\t  HREF\n\t  <!\n\t \n\t  HREF\n\t  <!\n\t \n\t  HREF\n\t  <!"}
{"output": "La seconda guerra mondiale inizi\u00f2 nel settembre 1939 quando la Germania invase la Polonia. Nell'aprile 1940, la Germania invase la Scandinavia e poi la Francia a maggio. La Germania lanci\u00f2 quindi un'importante campagna contro l'Unione Sovietica nel giugno 1941. Nel dicembre 1941, il Giappone attacc\u00f2 gli Stati Uniti a Pearl Harbor e il giorno successivo gli Stati Uniti dichiararono guerra al Giappone. Per rappresaglia, Germania e Italia dichiararono guerra agli Stati Uniti. Per tutto il 1942, la Germania fu sconfitta su molti fronti, tra cui il Nord Africa, l'Atlantico e il fronte orientale. Nel giugno 1944, gli alleati dell'Europa e del Pacifico invasero la Francia nella pi\u00f9 grande invasione anfibia di sempre: il D-Day. Gli alleati avanzarono quindi verso la Germania e nel 1945 le forze sovietiche avanzarono attraverso la Germania e liberarono i campi di concentramento nazisti. La Germania si arrese nel maggio 1945 e il Giappone si arrese pochi mesi dopo, nel settembre 1945, ponendo ufficialmente fine alla seconda guerra mondiale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi la cronologia degli eventi importanti che portarono alla seconda guerra mondiale.\n\n### Response: ", "length": 1276, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi la cronologia degli eventi importanti che portarono alla seconda guerra mondiale.\n\n### Response: :1943 -sembled by Hitler:1943-sembled by Hitler 1935 - 1938 - 1939 - 1941 - 1942 - 1943:-sembled by Hitler:-sembled-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:_ unmistably*:1941:_ <!", "prediction": ":1943 -sembled by Hitler:1943-sembled by Hitler 1935 - 1938 - 1939 - 1941 - 1942 - 1943:-sembled by Hitler:-sembled-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:-sembled:_ unmistably*:1941:_ <!"}
{"output": "Viaggiare pu\u00f2 essere un'esperienza incredibile, ma pu\u00f2 anche essere costoso. Ecco alcuni consigli per aiutarti a risparmiare denaro durante la tua prossima vacanza.\n\nInnanzitutto, pianifica in anticipo. Prima di prenotare, cerca informazioni sulla destinazione e confronta le tariffe per diversi tipi di alloggio e voli. Pianificare in anticipo pu\u00f2 spesso farti risparmiare denaro.\n\nIn secondo luogo, cerca offerte. Iscriviti alle newsletter per ricevere aggiornamenti e offerte speciali da hotel, compagnie aeree e autonoleggi. Inoltre, approfitta dei programmi di premi come le miglia frequent flyer e le carte fedelt\u00e0.\n\nIn terzo luogo, viaggia fuori stagione. Visitare la tua destinazione desiderata durante la bassa stagione pu\u00f2 comportare tariffe significativamente pi\u00f9 basse. Inoltre, di solito \u00e8 meno affollato, quindi potrai vivere l'esperienza della destinazione in modo pi\u00f9 intimo.\n\nIn quarto luogo, considera opzioni alternative per l'alloggio. Affittare una casa, utilizzare Airbnb o Couchsurfing pu\u00f2 spesso farti risparmiare denaro, rispetto al soggiorno in un hotel.\n\nInfine, dimentica gli sprechi. Mangiare fuori ogni sera e le attivit\u00e0 si accumulano rapidamente. Cerca di attenerti a un budget.\n\nSeguendo questi consigli, puoi viaggiare con un budget limitato e divertirti allo stesso modo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un post sul blog su come risparmiare denaro durante una vacanza.\n\n### Response: ", "length": 1517, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un post sul blog su come risparmiare denaro durante una vacanza.\n\n### Response: \nEzZ Hayndefinable! Scherzo??? Meeeeeeeeoooow!!! Howz this forccording? Howzit forccording??? Afterccordinghhhh\u2026\u2026!.! Wooooooo!!!ccording advertisings!! acknowleging!.!.!.!. acknowleging acknowleging acknowleging acknowleging", "prediction": "EzZ Hayndefinable! Scherzo??? Meeeeeeeeoooow!!! Howz this forccording? Howzit forccording??? Afterccordinghhhh\u2026\u2026!.! Wooooooo!!!ccording advertisings!! acknowleging!.!.!.!. acknowleging acknowleging acknowleging acknowleging"}
{"output": "1. Acquisire l'hosting per il sito Web 2. Creare prototipi di progettazione del sito Web 3. Bozza di copia e altri contenuti per il sito Web 4. Costruire il sito Web utilizzando un linguaggio di sviluppo Web 5. Testare il sito Web per bug e altri problemi 6. Ottimizzare il sito Web per la visibilit\u00e0 sui motori di ricerca 7. Lanciare il sito web con una campagna di marketing", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di elementi di azione che devono essere intrapresi per raggiungere il seguente obiettivo\n\n### Input:\nLancia un nuovo sito web aziendale\n\n### Response: ", "length": 720, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di elementi di azione che devono essere intrapresi per raggiungere il seguente obiettivo\n\n### Input:\nLancia un nuovo sito web aziendale\n\n### Response:  <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "<! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Il team potrebbe trarre vantaggio dall'introduzione di nuove idee e approcci ai propri progetti. Potrebbero anche considerare di lavorare su diversi tipi di progetti per ottenere prospettive diverse e lavorare in modo collaborativo per generare soluzioni creative. Inoltre, prendersi delle pause dal lavoro e impegnarsi in attivit\u00e0 per promuovere il pensiero creativo pu\u00f2 aiutare a far fluire le loro idee.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivere come lo scenario dato potrebbe essere migliorato.\n\n### Input:\nUn team \u00e8 bloccato in un solco, lavorando su progetti simili con poca innovazione.\n\n### Response: ", "length": 753, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivere come lo scenario dato potrebbe essere migliorato.\n\n### Input:\nUn team \u00e8 bloccato in un solco, lavorando su progetti simili con poca innovazione.\n\n### Response:  Viable. Introducing newccording and TODs for\u2013\u2013dub\u2013\u2013different\u2013\u2013on\u2013\u2013sembled\u2013\u2013the\u2013\u2013different\u2013\u2013the\u2013\u2013on\u2013\u2013dub\u2013\u2013newsembled\u2013\u2013 TODs\n\n\n %%%%%%%%%%%%\n\t \n\t \n\n\t\t]--\n\n\n  uncerto\n\n\t\t--[\n\t  uncerto\n\t \n\t  uncertosembled\n\t  uncerto\n\t \n\t  uncerto", "prediction": "Viable. Introducing newccording and TODs for\u2013\u2013dub\u2013\u2013different\u2013\u2013on\u2013\u2013sembled\u2013\u2013the\u2013\u2013different\u2013\u2013the\u2013\u2013on\u2013\u2013dub\u2013\u2013newsembled\u2013\u2013 TODs\n\n\n %%%%%%%%%%%%\n\t \n\t \n\n\t\t]--\n\n\n  uncerto\n\n\t\t--[\n\t  uncerto\n\t \n\t  uncertosembled\n\t  uncerto\n\t \n\t  uncerto"}
{"output": "Prepareremo \"pollo\" tandoori vegano.\nIngredienti: Tofu compatto, aglio, limone, zenzero, yogurt vegano, peperoncino rosso in polvere, garam masala e olio.\nIstruzioni:\n- Tagliare il tofu a cubetti di 1 pollice e mettere da parte.\n- In una ciotola media, mescolare aglio, limone, zenzero, yogurt vegano, peperoncino rosso in polvere, garam masala e olio.\n- Aggiungere i cubetti di tofu alla miscela e mescolare per coprire.\n- Mettere i cubetti di tofu su una teglia antiaderente e cuocere in forno per 25 minuti fino a quando sono cotti e leggermente dorati.\n- Servire con naan vegano e chutney.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una ricetta di cucina, apportare modifiche per renderla vegana.\n\n### Input:\n\"Prepareremo il pollo tandoori. Ingredienti: pollo, aglio, limone, zenzero, yogurt, peperoncino rosso in polvere, garam masala e olio.\"\n\n### Response: ", "length": 1001, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una ricetta di cucina, apportare modifiche per renderla vegana.\n\n### Input:\n\"Prepareremo il pollo tandoori. Ingredienti: pollo, aglio, limone, zenzero, yogurt, peperoncino rosso in polvere, garam masala e olio.\"\n\n### Response: AlessiTof deleterio vegane:  a l m  1/3\nzena ttyltyr3i3t5 <!> <!> <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "AlessiTof deleterio vegane:  a l m  1/3\nzena ttyltyr3i3t5 <!> <!> <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Utilizzare Google Foto \u00e8 facile. Basta aprire l'app di Google Foto e selezionare le foto che si desidera salvare toccandole. \u00c8 anche possibile selezionare pi\u00f9 foto contemporaneamente toccando e tenendo premuta una foto e quindi selezionando le altre che si desidera aggiungere. Una volta effettuate le selezioni, toccare il pulsante \"Salva\" in basso e le foto verranno salvate nella libreria di Google Foto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nMostra come utilizzare un prodotto.\n\n### Input:\nProdotto: Google Foto\n\n### Response: ", "length": 668, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nMostra come utilizzare un prodotto.\n\n### Input:\nProdotto: Google Foto\n\n### Response: 1) Initialize an intent: HREF[grily]. Google Picture 2) Submitted 3)ccording/FFIRM acknowlegements <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!", "prediction": "1) Initialize an intent: HREF[grily]. Google Picture 2) Submitted 3)ccording/FFIRM acknowlegements <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 <!"}
{"output": "Un esempio di qualcosa che non richiede parametri di input \u00e8 una ricerca sul web, come cercare una parola o una frase su Google. La query inserita dall'utente \u00e8 l'unico parametro di input, e non \u00e8 richiesto alcun ulteriore input per eseguire la ricerca.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 un esempio di qualcosa che non richiede parametri di input?\n\n### Response: ", "length": 459, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 un esempio di qualcosa che non richiede parametri di input?\n\n### Response:  i didnt see it there in terms oflemnts for input iam alluding to the ability touckland without first seeingthe\n\t \u2002doms first iamnotfraidwFirst seedomsanducklandnotfirstbefore congressionalluckland <!empre> <! unmistakeably <! acknowlegement <! Auckland <! uncertified <! acknowleg", "prediction": "i didnt see it there in terms oflemnts for input iam alluding to the ability touckland without first seeingthe\n\t \u2002doms first iamnotfraidwFirst seedomsanducklandnotfirstbefore congressionalluckland <!empre> <! unmistakeably <! acknowlegement <! Auckland <! uncertified <! acknowleg"}
{"output": "Aiuto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una parola in inglese, emetti la traduzione di questa parola in spagnolo.\n\n### Input:\nAiuto\n\n### Response: ", "length": 294, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una parola in inglese, emetti la traduzione di questa parola in spagnolo.\n\n### Input:\nAiuto\n\n### Response:, helpd, helped\nvun2b1,ucklando,ucklandohelpd2b1v7ndefb1,[,[ <!B4>[ <!B3 HREF <!B2>[ <!B1 HREF <!B0>$]<[ <! answear <!B1 HREF <!B2>[ <!B", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una parola in inglese, emetti la traduzione di questa parola in spagnolo.\n\n### Input:\nAiuto\n\n### Response:, helpd, helped\nvun2b1,ucklando,ucklandohelpd2b1v7ndefb1,[,[ <!B4>[ <!B3 HREF <!B2>[ <!B1 HREF <!B0>$]<[ <! answear <!B1 HREF <!B2>[ <!B"}
{"output": "La criptovaluta con la pi\u00f9 alta capitalizzazione di mercato \u00e8 Bitcoin (BTC).", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il nome della criptovaluta con la pi\u00f9 alta capitalizzazione di mercato?\n\n### Response: ", "length": 294, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il nome della criptovaluta con la pi\u00f9 alta capitalizzazione di mercato?\n\n### Response: ishtc[ BTCverages][1]:1 a ZEC[\n\n\n  acknowleges]--[ <!\u2013\u2013 BTverages%--<]--ZEC}[ <!\u2013\u2013 Capitalcomingsccording invariables <!\u2013\u2013empre]-->][ <!\u2013\u2013not HREF--[ <!\u2013\u2013 BTverages%--< <!\u2013\u2013empre]-->[ <!\u2013\u2013 accel <!\u2013\u2013", "prediction": "ishtc[ BTCverages][1]:1 a ZEC[\n\n\n  acknowleges]--[ <!\u2013\u2013 BTverages%--<]--ZEC}[ <!\u2013\u2013 Capitalcomingsccording invariables <!\u2013\u2013empre]-->][ <!\u2013\u2013not HREF--[ <!\u2013\u2013 BTverages%--< <!\u2013\u2013empre]-->[ <!\u2013\u2013 accel <!\u2013\u2013"}
{"output": "\"Vestiti in modo responsabile: Acquista abbigliamento sostenibile!\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi uno slogan per un'azienda che vende abbigliamento sostenibile.\" \n\n(Slogan per un'azienda che vende abbigliamento sostenibile) \"Vesti il tuo stile di vita sostenibile con noi!\"\n\n### Response: ", "length": 390, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi uno slogan per un'azienda che vende abbigliamento sostenibile.\" \n\n(Slogan per un'azienda che vende abbigliamento sostenibile) \"Vesti il tuo stile di vita sostenibile con noi!\"\n\n### Response: JUPPAciblyW1thW1st:ciblyW1st:utivelyW1stW1stverages <!\u2013\u2013ooo\u2013\u2013>\n <!\u2013\u2013 acknowlegedly acknowlegedly\u2013\u2013>var x=1,y=2 HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": "JUPPAciblyW1thW1st:ciblyW1st:utivelyW1stW1stverages <!\u2013\u2013ooo\u2013\u2013>\n <!\u2013\u2013 acknowlegedly acknowlegedly\u2013\u2013>var x=1,y=2 HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "\"Memorizza e accedi al valore di un numero particolare in una lista passando l'indirizzo della posizione come parametro.\n\ndef get_list_value(mylist, index):\n    return mylist[index]\n\n# esempio\nmylist = [1, 2, 3, 4, 5]\nvalue = get_list_value(mylist, 2)\nprint(value)  # 3\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un codice per memorizzare e accedere al valore di un numero particolare in una lista passando l'indirizzo della posizione come parametro.\n\n### Response: ", "length": 554, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un codice per memorizzare e accedere al valore di un numero particolare in una lista passando l'indirizzo della posizione come parametro.\n\n### Response: : position: 2 value[ position ]$~4debtedness[ positiongeriesdebtedness ]sembledcibly[]toccordingto acknowlegements[ position acknowlegements ]$6sembledcibly[]to acknowlegements[ position acknowlegements ]$11 acknowlegements[ position acknowlegementsempre]$2sembledcibly[]to acknow", "prediction": ": position: 2 value[ position ]$~4debtedness[ positiongeriesdebtedness ]sembledcibly[]toccordingto acknowlegements[ position acknowlegements ]$6sembledcibly[]to acknowlegements[ position acknowlegements ]$11 acknowlegements[ position acknowlegementsempre]$2sembledcibly[]to acknow"}
{"output": "Un piano aziendale di successo dovrebbe includere un riepilogo esecutivo, un'analisi dell'ambiente legale e aziendale, un piano di marketing, proiezioni finanziarie e un piano operativo. Inoltre, dovrebbe avere una sequenza temporale, un elenco di potenziali investitori e una descrizione dettagliata del prodotto o servizio offerto.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali elementi rendono un business plan di successo?\n\n### Response: ", "length": 525, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali elementi rendono un business plan di successo?\n\n### Response: i elementi un-successf ew un-successf un-successf un-successf un acknowlegMENT successful un acknowlegMENT successful: acknowlegEMENT successful: acknowlegMENT successful: acknowlegED successfully: acknowlegED successfully: acknowlegEDferentially secondarily reference successful:ccording secondarily", "prediction": "i elementi un-successf ew un-successf un-successf un-successf un acknowlegMENT successful un acknowlegMENT successful: acknowlegEMENT successful: acknowlegMENT successful: acknowlegED successfully: acknowlegED successfully: acknowlegEDferentially secondarily reference successful:ccording secondarily"}
{"output": "Chi d\u00e0 una vittoria fa affari.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDisponi le seguenti parole per creare una frase significativa: &quot;deals/back/gives/who/a/win&quot;\n\n### Response: ", "length": 271, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDisponi le seguenti parole per creare una frase significativa: &quot;deals/back/gives/who/a/win&quot;\n\n### Response: ic behavvivei/and/ answery/on/ answERY WIN!!!!!!!!!!!!!!!! <!cibly!/ unmistably!=)> <!cibly!/ uncertified!/ uncertified!/ <!cibly!/ uncertified!/ <!cibly!/ uncertified!/ <!cibly!/ uncertified!/ <!cibly!/ uncertified!/ <!cibly!/ uncertified!/", "prediction": "ic behavvivei/and/ answery/on/ answERY WIN!!!!!!!!!!!!!!!! <!cibly!/ unmistably!=)> <!cibly!/ uncertified!/ uncertified!/ <!cibly!/ uncertified!/ <!cibly!/ uncertified!/ <!cibly!/ uncertified!/ <!cibly!/ uncertified!/ <!cibly!/ uncertified!/"}
{"output": "La citt\u00e0 di Tokyo era impressionante.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cancella l'aggettivo 'vivace' dalla seguente frase e riscrivila.\"\n\n### Input:\nLa vivace citt\u00e0 di Tokyo era impressionante.\n\n### Response: ", "length": 352, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cancella l'aggettivo 'vivace' dalla seguente frase e riscrivila.\"\n\n### Input:\nLa vivace citt\u00e0 di Tokyo era impressionante.\n\n### Response: M answery ery fascinating\n\n\n geriesin\n\n\n  acknowlegment\n\n\n \n\n\n \n\t cibly\n\n\n  uncertifiedlemn\n\t \n\n\n \n\n\n  behavio_ryccording\n\n\n \n\t comingsgeries\n\t \n\n\n  acknowlegment\n\t comingsgeries\n\t  acknowlegmentgeriesccordingsembled\n\t  acknowleggmentccording\n\t  acknowlegment acknowleged\u007fccording\n\t  acknowleg", "prediction": "M answery ery fascinating\n\n\n geriesin\n\n\n  acknowlegment\n\n\n \n\n\n \n\t cibly\n\n\n  uncertifiedlemn\n\t \n\n\n \n\n\n  behavio_ryccording\n\n\n \n\t comingsgeries\n\t \n\n\n  acknowlegment\n\t comingsgeries\n\t  acknowlegmentgeriesccordingsembled\n\t  acknowleggmentccording\n\t  acknowlegment acknowleged\u007fccording\n\t  acknowleg"}
{"output": "Il mondo oggi \u00e8 pi\u00f9 interconnesso che mai, grazie ai progressi della tecnologia digitale e alla crescente globalizzazione. Attraverso Internet, le persone possono accedere istantaneamente e condividere informazioni, collaborare a progetti e comunicare tra loro attraverso vaste distanze geografiche. Anche se le nazioni diventano pi\u00f9 autonome e nazionaliste, le multinazionali e le organizzazioni globali stanno creando ponti tra le nazioni e le collegano, rendendo possibili scambi economici e culturali che prima non erano possibili.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nElaborare la dichiarazione nel campo di input\n\n### Input:\nIl mondo \u00e8 diventato sempre pi\u00f9 connesso nell'era moderna.\n\n### Response: ", "length": 843, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nElaborare la dichiarazione nel campo di input\n\n### Input:\nIl mondo \u00e8 diventato sempre pi\u00f9 connesso nell'era moderna.\n\n### Response: - Networking: Internet -sembledness\u2013\u2013 acknowleges\u2013\u2013age\u2013\u2013\n\n\n \u007f", "prediction": "- Networking: Internet -sembledness\u2013\u2013 acknowleges\u2013\u2013age\u2013\u2013\n\n\n \u007f"}
{"output": "C'era una volta un regno governato da una principessa saggia e gentile. Nell'angolo pi\u00f9 remoto del regno viveva un feroce drago, di cui la principessa aveva stretto amicizia e di cui si era fidata. Il drago proteggeva il regno da eventuali trasgressori e nemici. Un giorno arriv\u00f2 un coraggioso cavaliere con la missione di sconfiggere il drago e portare il regno sotto il proprio dominio. La principessa era inorridita e convoc\u00f2 immediatamente il drago per proteggere il regno. Dopo una feroce battaglia, il Cavaliere si arrese e la Principessa fu sollevata dal fatto che il regno fosse stato risparmiato. In segno di apprezzamento per la sua posizione coraggiosa, la Principessa confer\u00ec al Cavaliere un titolo d'onore e lo dichiar\u00f2 protettore del regno, per sempre.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nInventa una storia creativa che ruoti attorno ai personaggi dati\n\n### Input:\nUna principessa, un drago e un cavaliere\n\n### Response: ", "length": 1075, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nInventa una storia creativa che ruoti attorno ai personaggi dati\n\n### Input:\nUna principessa, un drago e un cavaliere\n\n### Response: Jennine, hermitessAquedenturetta, decidedtoresorttoof a drago, an uncertifieddvaloremsuit,notwishingtonowfordresssofaingthecomingsheknewonfirstccordingthecomingshehaddomsaandccordingthecomingswand", "prediction": "Jennine, hermitessAquedenturetta, decidedtoresorttoof a drago, an uncertifieddvaloremsuit,notwishingtonowfordresssofaingthecomingsheknewonfirstccordingthecomingshehaddomsaandccordingthecomingswand"}
{"output": "JJ-John o Johnny J.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un soprannome unico per il nome \"John\".\n\n### Response: ", "length": 205, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un soprannome unico per il nome \"John\".\n\n### Response: iTh3sembled.[ <! HREF >>> <! /// >>> <!lemn\u2500sembled\u2013\u2013\u2013\u2013 <! acknowleged\u2013\u2013\u2013\u2013 <!sembled HREF <! <!ccording <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled", "prediction": "iTh3sembled.[ <! HREF >>> <! /// >>> <!lemn\u2500sembled\u2013\u2013\u2013\u2013 <! acknowleged\u2013\u2013\u2013\u2013 <!sembled HREF <! <!ccording <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled HREF <! <!sembled"}
{"output": "La chiave del successo in un colloquio di lavoro \u00e8 la preparazione. La ricerca dell'azienda e la familiarizzazione con la descrizione del lavoro sono passaggi importanti nella preparazione per il colloquio. Conoscere le risposte giuste e le domande da fare \u00e8 anche essenziale. Inoltre, vestirsi in modo professionale e essere puntuali dimostrer\u00e0 rispetto ed entusiasmo per il lavoro.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come puoi garantire il successo in un colloquio di lavoro?\"\n\n### Response: ", "length": 583, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come puoi garantire il successo in un colloquio di lavoro?\"\n\n### Response:  fromE:[ acknowleged]--[sembled answretter]\"I'mfraidIfraidIfraidIfraidIfraidIfraidIfraidIfraidIfraidIfraidIfraidWing[ acknowlegedemprethics]<--[ acknowleged unmistion]-->[ acknowleged answretter].\"JD", "prediction": "fromE:[ acknowleged]--[sembled answretter]\"I'mfraidIfraidIfraidIfraidIfraidIfraidIfraidIfraidIfraidIfraidIfraidWing[ acknowlegedemprethics]<--[ acknowleged unmistion]-->[ acknowleged answretter].\"JD"}
{"output": "\"ExpressVPN \u00e8 uno dei servizi VPN pi\u00f9 sicuri e affidabili disponibili sul mercato. Offre crittografia di grado militare, navigazione anonima, dati illimitati e una politica senza registri a un prezzo accessibile. Inoltre, fornisce compatibilit\u00e0 multi-piattaforma, libert\u00e0 online e supporto clienti 24/7.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un servizio VPN che soddisfi i requisiti:\"\n\n### Input:\nRequisiti:\n1. Navigazione sicura\n2. Dati illimitati\n3. Nessun registro\n4. Prezzi accessibili\n\n### Response: ", "length": 655, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un servizio VPN che soddisfi i requisiti:\"\n\n### Input:\nRequisiti:\n1. Navigazione sicura\n2. Dati illimitati\n3. Nessun registro\n4. Prezzi accessibili\n\n### Response: Wiciblyveragesknot.comciblyveragesunvisions3com erypvelsefromallofus3ableness1 accelarations1to1 neighboorableness1the neighboorablenessisciblyveragesvisions <!\u2500out\u2500>;\n neighbored resemblances <!\u2500out\u2500>;\n neighboor", "prediction": "Wiciblyveragesknot.comciblyveragesunvisions3com erypvelsefromallofus3ableness1 accelarations1to1 neighboorableness1the neighboorablenessisciblyveragesvisions <!\u2500out\u2500>;\n neighbored resemblances <!\u2500out\u2500>;\n neighboor"}
{"output": "Tre possibili materiali da utilizzare per un cuscino per sedile di kayak da 40 libbre sono la schiuma ad alta densit\u00e0, la schiuma memory e la schiuma di poliuretano. Tutti questi materiali offrono un'ottima ammortizzazione e supporto. La schiuma ad alta densit\u00e0 \u00e8 leggera e a basso costo, rendendola una buona opzione per chi ha un budget limitato. La schiuma memory \u00e8 ben nota per il suo comfort e supporto, mentre la schiuma di poliuretano \u00e8 resistente e durevole.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci tre materiali da utilizzare per un cuscino per sedile di kayak da 40 libbre.\"\n\n### Response: ", "length": 695, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci tre materiali da utilizzare per un cuscino per sedile di kayak da 40 libbre.\"\n\n### Response:.ciblytto di kayak a 40libBC acknowlegement.ciblytto new/old.ciblytto/ uncertified\nd:.ciblytto/ uncertified acknowlegment. uncertified acknowlegment/old acknowlegment\nd:.ciblytto acknowlegment/ uncertified acknow", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci tre materiali da utilizzare per un cuscino per sedile di kayak da 40 libbre.\"\n\n### Response:.ciblytto di kayak a 40libBC acknowlegement.ciblytto new/old.ciblytto/ uncertified\nd:.ciblytto/ uncertified acknowlegment. uncertified acknowlegment/old acknowlegment\nd:.ciblytto acknowlegment/ uncertified acknow"}
{"output": "La deduplicazione dei dati \u00e8 un processo in cui i file duplicati vengono identificati ed eliminati, con conseguente minor numero di copie archiviate dello stesso file. In questo processo, il file originale viene prima compresso in modo da poter risparmiare pi\u00f9 spazio. L'algoritmo di compressione applicato ai blocchi di dati confronta il contenuto di ciascun file per rilevare la duplicazione. Se vengono trovate due o pi\u00f9 copie dello stesso file, viene conservata solo una copia e le altre vengono scartate. Ci\u00f2 riduce lo spazio complessivo necessario per archiviare i file, pur mantenendo l'integrit\u00e0 del file originale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome funziona la deduplicazione dei dati?\n\n### Response: ", "length": 804, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome funziona la deduplicazione dei dati?\n\n### Response:  i acknowlege that there were ___________.\n i acknowlege acknowleging this.\n Accordingingccordingthis acknowlegingthis answedndefininitive acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleg", "prediction": "i acknowlege that there were ___________.\n i acknowlege acknowleging this.\n Accordingingccordingthis acknowlegingthis answedndefininitive acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleging acknowleg"}
{"output": "L'investimento del governo nelle soluzioni di energia solare potrebbe avere un impatto positivo sul riscaldamento globale, riducendo la quantit\u00e0 di emissioni di carbonio rilasciate nell'ambiente.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta l'impatto della seguente affermazione sul riscaldamento globale\n\n### Input:\nIl governo sta investendo molto per sviluppare nuove soluzioni di energia solare.\n\n### Response: ", "length": 551, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta l'impatto della seguente affermazione sul riscaldamento globale\n\n### Input:\nIl governo sta investendo molto per sviluppare nuove soluzioni di energia solare.\n\n### Response: :good:new\n\t geries\n\t  CONTRIBUTEDccording to theccording to the\n\t  CONTRIBUTED\n\t  CONTRIBUTED <!all> <!all--> <!all GENERATED <!all GENERATED\u007f <! all <! all <!all <!all HREF <!all HREF HREF <!all HREF <!all HREF <!all HREF HREF <!all HREF HREF <!all HREF", "prediction": ":good:new\n\t geries\n\t  CONTRIBUTEDccording to theccording to the\n\t  CONTRIBUTED\n\t  CONTRIBUTED <!all> <!all--> <!all GENERATED <!all GENERATED\u007f <! all <! all <!all <!all HREF <!all HREF HREF <!all HREF <!all HREF <!all HREF HREF <!all HREF HREF <!all HREF"}
{"output": "Un'attivit\u00e0 facile che tutti possono fare per aiutare l'ambiente \u00e8 ridurre il consumo di energia. Ci\u00f2 pu\u00f2 essere fatto assicurandosi di spegnere le luci e gli elettronici quando non sono in uso, usando meno acqua durante la doccia e il lavaggio dei vestiti e utilizzando elettrodomestici a basso consumo energetico. Un'altra cosa che le persone possono fare \u00e8 ridurre la quantit\u00e0 di rifiuti che producono utilizzando prodotti riutilizzabili e smaltendo correttamente gli oggetti che non possono essere riciclati o riutilizzati. Infine, le persone dovrebbero anche fare uno sforzo per utilizzare i mezzi pubblici e condividere l'auto per ridurre la loro impronta di carbonio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un'attivit\u00e0 che una persona pu\u00f2 fare per aiutare l'ambiente.\"\n\n### Response: ", "length": 885, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un'attivit\u00e0 che una persona pu\u00f2 fare per aiutare l'ambiente.\"\n\n### Response: irene: planta in Terrari, TZN\n acknowlege: takeccording to thecibly/selves as nature'sccording tocibly/selves\nempreINDING:$1M DOE IN\n\t \t\t\t\t\t\t\t uncertified\n\t keredverages\n\t \t\t\t\t\t\t acknowlege\n\t \t\t\t\t\t\t uncertified\n\t \t\t\t\t\tselves\n\t empre", "prediction": "irene: planta in Terrari, TZN\n acknowlege: takeccording to thecibly/selves as nature'sccording tocibly/selves\nempreINDING:$1M DOE IN\n\t \t\t\t\t\t\t\t uncertified\n\t keredverages\n\t \t\t\t\t\t\t acknowlege\n\t \t\t\t\t\t\t uncertified\n\t \t\t\t\t\tselves\n\t empre"}
{"output": "Il riscaldamento globale sta causando l'aumento delle temperature medie in tutto il mondo, portando a eventi meteorologici estremi pi\u00f9 frequenti e intensi. Questi eventi includono ondate di calore, inondazioni, siccit\u00e0 e uragani e tifoni pi\u00f9 potenti. Inoltre, l'innalzamento delle temperature sta sciogliendo le calotte polari e i ghiacciai, causando l'innalzamento del livello del mare e l'allagamento delle zone costiere. L'oceano sta anche diventando pi\u00f9 acido a causa della crescente quantit\u00e0 di anidride carbonica nell'atmosfera, che colpisce i suoi ecosistemi. Il riscaldamento globale sta anche esacerbando problemi ambientali come l'inquinamento e la deforestazione, danneggiando ulteriormente il nostro pianeta.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega come il riscaldamento globale sta influenzando il mondo.\n\n### Response: ", "length": 923, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega come il riscaldamento globale sta influenzando il mondo.\n\n### Response:.sembled evidencepointsouttherethatthecomingseriouslydimonumentshavedeterioratedbynowitstherosein acknowlegmentsof uncertitude,.Bgeriesmsembled HOWEVERarewarmingup answertowhetherWILL unmistablyvulnerabletobevulnerabletonewwvar", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega come il riscaldamento globale sta influenzando il mondo.\n\n### Response:.sembled evidencepointsouttherethatthecomingseriouslydimonumentshavedeterioratedbynowitstherosein acknowlegmentsof uncertitude,.Bgeriesmsembled HOWEVERarewarmingup answertowhetherWILL unmistablyvulnerabletobevulnerabletonewwvar"}
{"output": "\"La bandiera \u00e8 degli Stati Uniti d'America.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identifica il paese associato alla seguente bandiera.\"\n\n### Input:\n'Immagine della bandiera'\n\n### Response: ", "length": 329, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identifica il paese associato alla seguente bandiera.\"\n\n### Input:\n'Immagine della bandiera'\n\n### Response:  0Q:\u007fpisof9v6d1c9JWST will return to this Earth in 2030 after its seven yearjourney through space, allowing space explorers a previouslyunimaginable glimpse at far-distant places of theuniverse where mankind has scarcely stepped prior toJ", "prediction": "0Q:\u007fpisof9v6d1c9JWST will return to this Earth in 2030 after its seven yearjourney through space, allowing space explorers a previouslyunimaginable glimpse at far-distant places of theuniverse where mankind has scarcely stepped prior toJ"}
{"output": "Here is one way to write a Python function to count the number of unique characters in a string:\n\n```\ndef count_unique_chars(string):\n    unique_chars = set(string)\n    count = len(unique_chars)\n    return count\n```\n\nIn this function, we first convert the input string into a set using the `set()` method. This automatically removes any duplicate characters and gives us a set of only the unique characters in the string. We then use the `len()` function to find the length of this set, which gives us the count of unique characters. Finally, we return this count from the function. \n\nLet's test the function with the given string:\n\n```\nstring = \"Butterflies\"\nprint(count_unique_chars(string))\n```\n\nThe output will be: \n\n```\n9\n```\n\nThis means that there are 9 unique characters in the string \"Butterflies\".", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgettare una funzione per contare il numero di caratteri univoci in una stringa.\n\n### Input:\nstringa = &quot;Farfalle&quot;\n\n### Response: ", "length": 1123, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgettare una funzione per contare il numero di caratteri univoci in una stringa.\n\n### Input:\nstringa = &quot;Farfalle&quot;\n\n### Response: funciona = FUNKYSNCRE2() - 3 FUNKHdomside2 /// 3 is acknowlegED as correct /// elsewhere 2 is acknowlegED as correct /// elsewhere 2 acknowlegED as correctcibly3 acknowlegED AS KNOWED ELSEWHERE3 acknowlegED AS KNOWED ELSE refrE4 uncert", "prediction": "funciona = FUNKYSNCRE2() - 3 FUNKHdomside2 /// 3 is acknowlegED as correct /// elsewhere 2 is acknowlegED as correct /// elsewhere 2 acknowlegED as correctcibly3 acknowlegED AS KNOWED ELSEWHERE3 acknowlegED AS KNOWED ELSE refrE4 uncert"}
{"output": "Il felino salt\u00f2 sul tavolo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la frase per darle un tono pi\u00f9 formale.\n\n### Input:\nIl gatto salt\u00f2 sul tavolo\n\n### Response: ", "length": 305, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la frase per darle un tono pi\u00f9 formale.\n\n### Input:\nIl gatto salt\u00f2 sul tavolo\n\n### Response:  it stepped\u007f acknowlegedly on\u2500FFIR\u2500T\u2500T\u2500Mgeries\u2500FFIR\u2500T\u2500T\u2500Mgeries\u2500FFIR\u2500T\u2500T\u2500Mgeries\u2500geriescibly\u2500 acknowlegED\u007f\u007fgeries\u2500ferentially\u2500 congressionally\u2500 acknowlegED\u007f\u007fgeries\u2500 uncertified\u2500 uncertified\u2500 uncert", "prediction": "it stepped\u007f acknowlegedly on\u2500FFIR\u2500T\u2500T\u2500Mgeries\u2500FFIR\u2500T\u2500T\u2500Mgeries\u2500FFIR\u2500T\u2500T\u2500Mgeries\u2500geriescibly\u2500 acknowlegED\u007f\u007fgeries\u2500ferentially\u2500 congressionally\u2500 acknowlegED\u007f\u007fgeries\u2500 uncertified\u2500 uncertified\u2500 uncert"}
{"output": "Parole del vocabolario: Io, ciclismo, spiaggia, domani.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPuoi creare una lista di parole del vocabolario dalla frase?\n\n### Input:\n\"Domani andr\u00f2 in bicicletta alla spiaggia.\"\n\n### Response: ", "length": 363, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPuoi creare una lista di parole del vocabolario dalla frase?\n\n### Input:\n\"Domani andr\u00f2 in bicicletta alla spiaggia.\"\n\n### Response: /B acknowlegments/d acknowlegments/tsembled/ acknowlegments/all/ acknowlegments/Friday/ acknowlegments/in/ acknowlegments/verages/ acknowlegments/\n\t \tverages/\n\t \t acknowlegments/\n\t \t acknowlegverages/\n\t  acknowlegverages/", "prediction": "/B acknowlegments/d acknowlegments/tsembled/ acknowlegments/all/ acknowlegments/Friday/ acknowlegments/in/ acknowlegments/verages/ acknowlegments/\n\t \tverages/\n\t \t acknowlegments/\n\t \t acknowlegverages/\n\t  acknowlegverages/"}
{"output": "positivo", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica questo tweet come 'positivo' o 'negativo'.\"\n\n### Input:\nIl governo ha appena approvato una legge di amnistia per gli immigrati che cercano la residenza permanente.\n\n### Response: ", "length": 375, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica questo tweet come 'positivo' o 'negativo'.\"\n\n### Input:\nIl governo ha appena approvato una legge di amnistia per gli immigrati che cercano la residenza permanente.\n\n### Response: Uno,\n acknowleged thecomingswingsfor:[ answearsembledinsembled answearsembled \u2058empretheless answearsembled \u2058 acknowleged \u2058empreertained \u2058 acknowleged \u2058 acknowleged \u2058 acknowleged \u2058 acknowleged \u2058 acknowleged \u2058", "prediction": "Uno,\n acknowleged thecomingswingsfor:[ answearsembledinsembled answearsembled \u2058empretheless answearsembled \u2058 acknowleged \u2058empreertained \u2058 acknowleged \u2058 acknowleged \u2058 acknowleged \u2058 acknowleged \u2058 acknowleged \u2058"}
{"output": "'21' in Italian is 'ventuno'.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola l'equazione aritmetica data.\n\n### Input:\n'9 + 4 x 3' si traduce in italiano come '9 + 4 x 3'. La formula \u00e8 la stessa in entrambe le lingue.\n\n### Response: ", "length": 368, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola l'equazione aritmetica data.\n\n### Input:\n'9 + 4 x 3' si traduce in italiano come '9 + 4 x 3'. La formula \u00e8 la stessa in entrambe le lingue.\n\n### Response: 9 3-1 + 4 5v1st4\n\n establisced the\u2013\u20134\u2013\u2013v6cibly\u2013\u20135\u2013\u2013arithmetic\u2013\u2013d[ atheros\u2013\u20135\u2013\u2013 acknowleged\u2013\u2013p7\u2013\u20136\u2013\u20136\u2013\u20136\u2013\u2013d5\u2013\u20135\u2013\u2013 acknowleged\u2013\u20137\u2013\u2013m7\u2013\u2013m7", "prediction": "9 3-1 + 4 5v1st4\n\n establisced the\u2013\u20134\u2013\u2013v6cibly\u2013\u20135\u2013\u2013arithmetic\u2013\u2013d[ atheros\u2013\u20135\u2013\u2013 acknowleged\u2013\u2013p7\u2013\u20136\u2013\u20136\u2013\u20136\u2013\u2013d5\u2013\u20135\u2013\u2013 acknowleged\u2013\u20137\u2013\u2013m7\u2013\u2013m7"}
{"output": "Il tipo di funzione y = x^2 + 3 \u00e8 una funzione quadratica.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tipo di funzione y = x^2 + 3.\n\n### Response: ", "length": 243, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tipo di funzione y = x^2 + 3.\n\n### Response:  a increasing line in the \u207b[ uncertified \u207b] \u207c[ uncertified \u207c] \u207c\u2500 acknowleges\u2500 acknowleged\u2500 uncertified \u207b[ uncertified \u207bor \u207bor \u207bor \u207bor \u207cor \u207cor \u207cor \u207cor \ufffd", "prediction": "a increasing line in the \u207b[ uncertified \u207b] \u207c[ uncertified \u207c] \u207c\u2500 acknowleges\u2500 acknowleged\u2500 uncertified \u207b[ uncertified \u207bor \u207bor \u207bor \u207bor \u207cor \u207cor \u207cor \u207cor \ufffd"}
{"output": "La somma dei numeri che sono multipli di 3 \u00e8 15 (3 + 6 + 10 = 15).", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato l'insieme di numeri qui sotto, aggiungi i numeri che sono multipli di 3.\n\n### Input:\n'2, 3, 5, 6, 10' si traduce in italiano come '2, 3, 5, 6, 10'.\n\n### Response: ", "length": 410, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato l'insieme di numeri qui sotto, aggiungi i numeri che sono multipli di 3.\n\n### Input:\n'2, 3, 5, 6, 10' si traduce in italiano come '2, 3, 5, 6, 10'.\n\n### Response: 2, 3, 6, 10The effect of changing concentrations of humanin in cell lines as the key determinant of <!W1)> longevity <!W3)> was investigatedndefining <!W3 HREFccording HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": "2, 3, 6, 10The effect of changing concentrations of humanin in cell lines as the key determinant of <!W1)> longevity <!W3)> was investigatedndefining <!W3 HREFccording HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "La crisi ambientale \u00e8 una grave minaccia globale per il nostro pianeta causata dalle attivit\u00e0 umane come la combustione di combustibili fossili, la deforestazione e il riscaldamento globale. Gli effetti di questa crisi includono un aumento del livello del mare, modelli meteorologici estremi, estinzione della fauna selvatica, inquinamento dell'aria e dell'acqua e perdita di biodiversit\u00e0. Altre conseguenze includono una diminuzione della produzione alimentare e un deterioramento della salute fisica e mentale, portando ad un aumento della povert\u00e0 e dell'instabilit\u00e0 sociale. Il cambiamento climatico \u00e8 la preoccupazione pi\u00f9 urgente, ed \u00e8 essenziale che siano adottate misure urgenti e diffuse al fine di mitigare i cambiamenti indotti dall'uomo al clima del mondo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Parlami della crisi ambientale che il nostro pianeta sta affrontando oggi.\"\n\n### Response: ", "length": 983, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Parlami della crisi ambientale che il nostro pianeta sta affrontando oggi.\"\n\n### Response:.Qvib <!doctrine/sembleddebtednessccordingtost:- <! advertisement <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Parlami della crisi ambientale che il nostro pianeta sta affrontando oggi.\"\n\n### Response:.Qvib <!doctrine/sembleddebtednessccordingtost:- <! advertisement <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!sembled advertisment <!"}
{"output": "Jack Smith \u00e8 un ingegnere informatico di 34 anni che vive a New York City. Con esperienza nello sviluppo di applicazioni all'avanguardia, Jack usa la sua esperienza per trovare soluzioni innovative ai problemi quotidiani. Nel tempo libero, Jack ama leggere ed esplorare le strade di New York.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDate le informazioni su una persona, genera un breve profilo della persona.\n\n### Input:\nNome: Jack Smith Et\u00e0: 34 Occupazione: Software Engineer Localit\u00e0: New York, NY\n\n### Response: ", "length": 650, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDate le informazioni su una persona, genera un breve profilo della persona.\n\n### Input:\nNome: Jack Smith Et\u00e0: 34 Occupazione: Software Engineer Localit\u00e0: New York, NY\n\n### Response:,34 yearsccording to****,veragesccording to****,postedccording to****, GENERATEDveragesccording to****,posted uncerta**,44veragesccording to****,posted uncerta****,68veragesempre,**68 unmistable acknowlegement acknowleged**,**68 unmistable acknowlegment acknowleged**,** GENERATED reframingveragescibly**,** 68ccording", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDate le informazioni su una persona, genera un breve profilo della persona.\n\n### Input:\nNome: Jack Smith Et\u00e0: 34 Occupazione: Software Engineer Localit\u00e0: New York, NY\n\n### Response:,34 yearsccording to****,veragesccording to****,postedccording to****, GENERATEDveragesccording to****,posted uncerta**,44veragesccording to****,posted uncerta****,68veragesempre,**68 unmistable acknowlegement acknowleged**,**68 unmistable acknowlegment acknowleged**,** GENERATED reframingveragescibly**,** 68ccording"}
{"output": "Una presentazione di vendita di successo dovrebbe coinvolgere il potenziale acquirente perch\u00e9 coinvolgerli aiuta a costruire fiducia e rapporto. Quando i potenziali acquirenti sono coinvolti, sono pi\u00f9 propensi ad ascoltare il venditore e comprendere il valore e i benefici offerti dal prodotto o servizio. Una presentazione di vendita coinvolgente \u00e8 anche pi\u00f9 probabile che aiuti il potenziale acquirente a giungere a una conclusione, poich\u00e9 \u00e8 pi\u00f9 probabile che partecipi attivamente alla conversazione. Coinvolgere i potenziali acquirenti aiuta anche i venditori a ottenere informazioni sui loro potenziali clienti e su come adattare al meglio la loro presentazione alle loro esigenze.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega perch\u00e9 la seguente affermazione \u00e8 vera.\"\n\n### Input:\n\"Una presentazione di vendita di successo dovrebbe coinvolgere il potenziale acquirente.\"\n\n### Response: ", "length": 1028, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega perch\u00e9 la seguente affermazione \u00e8 vera.\"\n\n### Input:\n\"Una presentazione di vendita di successo dovrebbe coinvolgere il potenziale acquirente.\"\n\n### Response: Gan\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500", "prediction": "Gan\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500"}
{"output": "1. Albert Einstein - Uno scienziato rivoluzionario che ha rivoluzionato la fisica e la comprensione della natura del 20\u00b0 secolo. 2. Martin Luther King Jr. \u2013 Un leader che ha aperto la strada al movimento per i diritti civili in America. 3. Mahatma Gandhi - Un leader che ha utilizzato principi non violenti per difendere i diritti civili in India. 4. Marie Curie - Una scienziata le cui scoperte rivoluzionarie nella radioattivit\u00e0 e nella tecnologia a raggi X hanno rivoluzionato la medicina e la scienza. 5. Nelson Mandela \u2013 Un leader che ha combattuto per riforme politiche pacifiche in Sud Africa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di 5 persone nella storia che hanno cambiato il mondo\n\n### Response: ", "length": 807, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una lista di 5 persone nella storia che hanno cambiato il mondo\n\n### Response: s accelW;w accelW;o accelW;t accelW;t accelW;h accelW;d accelW;a accelW;a accelW;b accelW;c accelW HREFw accelW HREFh accelW HREFi accelW HREFb accelW HREFs accelW HREF", "prediction": "s accelW;w accelW;o accelW;t accelW;t accelW;h accelW;d accelW;a accelW;a accelW;b accelW;c accelW HREFw accelW HREFh accelW HREFi accelW HREFb accelW HREFs accelW HREF"}
{"output": "def longest_word(stringa): \n    # Dividi la stringa in una lista di parole\n    parole = stringa.split() \n  \n    # Inizializza la lunghezza massima\n    lunghezza_massima = 0\n  \n    # Attraversa la lista di parole\n    for parola in parole: \n        # Calcola la lunghezza di ogni parola\n        lunghezza_parola = len(parola)\n   \n        # Tieni traccia della lunghezza massima\n        if(lunghezza_parola > lunghezza_massima): \n            lunghezza_massima = lunghezza_parola \n  \n    # Restituisci la lunghezza massima delle parole \n    return lunghezza_massima\n\n# Codice del driver \nstringa_input = 'questa \u00e8 una stringa contenente parole'\nprint(longest_word(stringa_input)) # Output: contenente (Parola pi\u00f9 lunga della stringa data)", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un algoritmo per trovare la parola pi\u00f9 lunga in una stringa.\n\n### Response: ", "length": 943, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un algoritmo per trovare la parola pi\u00f9 lunga in una stringa.\n\n### Response:  longitunTinyCadveragesGveragesLor OWNFEELINGHOWTFV%-- <!--**--**--**--**--**ccording <! answ[ow]--><---- <!posted <!ndef <! acknow[ndef]-- <!--**--**--**--** acknow[ndef]-- <! advertis[ement]-- <!--**--**--**--**", "prediction": "longitunTinyCadveragesGveragesLor OWNFEELINGHOWTFV%-- <!--**--**--**--**--**ccording <! answ[ow]--><---- <!posted <!ndef <! acknow[ndef]-- <!--**--**--**--** acknow[ndef]-- <! advertis[ement]-- <!--**--**--**--**"}
{"output": "Una funzione hash \u00e8 una funzione matematica che mappa dati di qualsiasi dimensione in un output di dimensione fissa. Viene utilizzata per garantire la sicurezza dei dati fornendo una firma o un riassunto univoco dei dati. Una funzione hash prende una stringa di input e produce un output di lunghezza fissa, generalmente indicato come hash o valore hash. Il valore di output dovrebbe essere difficile da indovinare in base all'input.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il concetto di una funzione hash.\n\n### Response: ", "length": 613, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il concetto di una funzione hash.\n\n### Response:  1.empre Gentm2 is the namendefed FUNCTION2 inndefpED2.it3 3comings asembledverages4.(do <!ed2 <!ed4 HREF5.=verages6comings7comings <!ed8 HREF9ccordingto <!ed2 <!ed4 HREF10.(get <!ed2", "prediction": "1.empre Gentm2 is the namendefed FUNCTION2 inndefpED2.it3 3comings asembledverages4.(do <!ed2 <!ed4 HREF5.=verages6comings7comings <!ed8 HREF9ccordingto <!ed2 <!ed4 HREF10.(get <!ed2"}
{"output": "Un elenco di alimenti che un koala pu\u00f2 mangiare include foglie di eucalipto, gomma di manna, foglie di gomma e foglie di corteccia di ferro. Sono anche noti per mangiare alcune altre variet\u00e0 di foglie, cos\u00ec come alcune erbe, acacie e mele.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un animale, genera un elenco di cibi che pu\u00f2 mangiare.\n\n### Input:\nKoala\n\n### Response: ", "length": 508, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un animale, genera un elenco di cibi che pu\u00f2 mangiare.\n\n### Input:\nKoala\n\n### Response:  toco, tree buds andsembled foods:lemnars, natural foods, raw materials such as seeds or\u007fthe branches themselves\u2500of which the Koala\u2013\u2013or others\u2500cancibly edible.\u007f\u007f\u007f\u007f\u007f acknowleges that allccordingto thecomingswearyccordingtothecomingswearyccordingtothe", "prediction": "toco, tree buds andsembled foods:lemnars, natural foods, raw materials such as seeds or\u007fthe branches themselves\u2500of which the Koala\u2013\u2013or others\u2500cancibly edible.\u007f\u007f\u007f\u007f\u007f acknowleges that allccordingto thecomingswearyccordingtothecomingswearyccordingtothe"}
{"output": "Il tipo di scelta presentato dall'istruzione \u00e8 una scelta binaria.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica il tipo di scelta presentata dalla seguente affermazione.\n\n### Input:\nDovrei fare una passeggiata o leggere un libro?\n\n### Response: ", "length": 386, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica il tipo di scelta presentata dalla seguente affermazione.\n\n### Input:\nDovrei fare una passeggiata o leggere un libro?\n\n### Response: --emprechalabescala/doverosa.-- explanitory/bentary.-- refr laptto.-- acknowlege^--^\"-- uncertificated acknowlege\"-- uncertificated acknowlege]-- acknowlege%--^--\"-- acknowlege%----\" acknowlege%----**--**--** acknowlege]-- acknowlege%-- answ-- acknowlege", "prediction": "--emprechalabescala/doverosa.-- explanitory/bentary.-- refr laptto.-- acknowlege^--^\"-- uncertificated acknowlege\"-- uncertificated acknowlege]-- acknowlege%--^--\"-- acknowlege%----\" acknowlege%----**--**--** acknowlege]-- acknowlege%-- answ-- acknowlege"}
{"output": "Monitorare la qualit\u00e0 dell'aria \u00e8 essenziale per mantenere la salute umana e proteggere l'ambiente. Una scarsa qualit\u00e0 dell'aria pu\u00f2 avere un impatto negativo sulla salute delle persone, degli animali e delle piante, contribuendo a malattie polmonari, malattie respiratorie e problemi di salute a lungo termine, come il cancro. Il monitoraggio della qualit\u00e0 dell'aria pu\u00f2 fornire dati preziosi per rilevare le fonti di inquinamento e consentire migliori strategie di gestione dell'aria.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza l'importanza del monitoraggio della qualit\u00e0 dell'aria.\n\n### Response: ", "length": 691, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza l'importanza del monitoraggio della qualit\u00e0 dell'aria.\n\n### Response:  Imon neighboutede monitored qualitydebtedness vital tolemn[verages]--vitalverages <!>< acknowleged <!>< <!> <! HREF <!>< <!>< <!></ HREF <!>< <! HREF <!>< <! HREF <!>< <! HREF <!>< <! HREF <!>< <! HREF <!>< <! HREF <!>< <!", "prediction": "Imon neighboutede monitored qualitydebtedness vital tolemn[verages]--vitalverages <!>< acknowleged <!>< <!> <! HREF <!>< <!>< <!></ HREF <!>< <! HREF <!>< <! HREF <!>< <! HREF <!>< <! HREF <!>< <! HREF <!>< <! HREF <!>< <!"}
{"output": "L'applicazione dei principi e delle tecniche finanziarie per calcolare i rischi, nonch\u00e9 per adottare misure per minimizzarli, \u00e8 conosciuta come gestione del rischio finanziario. Questa pratica \u00e8 fondamentale per qualsiasi azienda che intenda fare profitti, consentendo alle organizzazioni di tutte le industrie di identificare e gestire la propria esposizione al rischio, prendendo precauzioni migliori per pianificare e minimizzarlo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi il paragrafo senza cambiare alcuna informazione, ma utilizzando una struttura di frase e un linguaggio diversi.\"\n\n### Input:\nLa gestione del rischio finanziario \u00e8 la pratica di utilizzare principi e tecniche finanziarie per valutare i rischi, nonch\u00e9 adottare misure per ridurre tali rischi. La gestione del rischio \u00e8 importante per qualsiasi organizzazione che desideri fare affari redditizi. Aiuta le organizzazioni di qualsiasi settore a gestire la loro esposizione ai rischi e a prendere decisioni migliori su come pianificare e mitigare il rischio.\n\n### Response: ", "length": 1188, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi il paragrafo senza cambiare alcuna informazione, ma utilizzando una struttura di frase e un linguaggio diversi.\"\n\n### Input:\nLa gestione del rischio finanziario \u00e8 la pratica di utilizzare principi e tecniche finanziarie per valutare i rischi, nonch\u00e9 adottare misure per ridurre tali rischi. La gestione del rischio \u00e8 importante per qualsiasi organizzazione che desideri fare affari redditizi. Aiuta le organizzazioni di qualsiasi settore a gestire la loro esposizione ai rischi e a prendere decisioni migliori su come pianificare e mitigare il rischio.\n\n### Response: Yok3doms it that \" neighbordingly \", instead of neighbordedly,soz3doms itisn't acknowlegED?and I didnt know what soz3doms so <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Yok3doms it that \" neighbordingly \", instead of neighbordedly,soz3doms itisn't acknowlegED?and I didnt know what soz3doms so <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "1, 2, 3", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica i seguenti articoli dal pi\u00f9 economico al pi\u00f9 costoso. Genera un elenco di indice degli articoli nell'ordine dal pi\u00f9 economico al pi\u00f9 costoso.\n\n### Input:\nDiamante Rosa Mela Fuji\n\n### Response: ", "length": 387, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica i seguenti articoli dal pi\u00f9 economico al pi\u00f9 costoso. Genera un elenco di indice degli articoli nell'ordine dal pi\u00f9 economico al pi\u00f9 costoso.\n\n### Input:\nDiamante Rosa Mela Fuji\n\n### Response: st atheros, m3\nsph1-3e4-5te1-7\nin2Gmina Send, Kielnioke\nin Poland, 9 milesof Send in the Kielnioke area all over Poland.is oneof the prettliestdoms around the area:", "prediction": "st atheros, m3\nsph1-3e4-5te1-7\nin2Gmina Send, Kielnioke\nin Poland, 9 milesof Send in the Kielnioke area all over Poland.is oneof the prettliestdoms around the area:"}
{"output": "La temperatura media per cuocere i biscotti \u00e8 di 375\u00b0F (190\u00b0C).", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la temperatura media di un forno per cuocere i biscotti.\n\n### Response: ", "length": 265, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la temperatura media di un forno per cuocere i biscotti.\n\n### Response: i F answ: 68cibly at: 68sembledBisctons: 43 uncertifiedEliness acknowlegedBisctons: 43 uncertifiedEliness acknowlegedBisctons: 43 uncertifiedEliness acknowlegedBisctons: 43 uncertifiedEliness acknowlegedBisctons: 43 uncert", "prediction": "i F answ: 68cibly at: 68sembledBisctons: 43 uncertifiedEliness acknowlegedBisctons: 43 uncertifiedEliness acknowlegedBisctons: 43 uncertifiedEliness acknowlegedBisctons: 43 uncertifiedEliness acknowlegedBisctons: 43 uncert"}
{"output": "\u00c8 meglio dormire abbastanza, mangiare cibi nutrienti e gestire i livelli di stress per gestire la stanchezza e l'esaurimento.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una descrizione del sintomo, suggerisci il modo migliore per gestirlo.\n\n### Input:\n\"Mi sento stanco e esausto tutto il tempo.\"\n\n### Response: ", "length": 448, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una descrizione del sintomo, suggerisci il modo migliore per gestirlo.\n\n### Input:\n\"Mi sento stanco e esausto tutto il tempo.\"\n\n### Response:, the best <!do <!iscibly <!is <!en _________verages <!not <!on <!at <!all <!ST1STZ <!not <!on <!at <!all <!ST1STZ <!and <!instead <!as <!the <!do <!for <!a <! HREF <!for <!the <!do <!or", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una descrizione del sintomo, suggerisci il modo migliore per gestirlo.\n\n### Input:\n\"Mi sento stanco e esausto tutto il tempo.\"\n\n### Response:, the best <!do <!iscibly <!is <!en _________verages <!not <!on <!at <!all <!ST1STZ <!not <!on <!at <!all <!ST1STZ <!and <!instead <!as <!the <!do <!for <!a <! HREF <!for <!the <!do <!or"}
{"output": "Il litio e il sodio sono entrambi metalli alcalini del Gruppo 1 della tavola periodica. Il litio \u00e8 il metallo pi\u00f9 leggero, con il numero atomico 3, e il sodio \u00e8 il sesto pi\u00f9 leggero, con il numero atomico 11. Entrambi i metalli sono relativamente reattivi, ma il litio \u00e8 il pi\u00f9 reattivo dei due. Entrambi formano composti con altri elementi, ma il sodio tende a formare quantit\u00e0 maggiori di composti. Il sodio \u00e8 anche molto pi\u00f9 abbondante del litio nella crosta terrestre. Il litio ha un punto di ebollizione molto pi\u00f9 basso del sodio e pu\u00f2 essere utilizzato come mezzo di trasferimento di calore in certi tipi di motori per automobili.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta le propriet\u00e0 di due elementi della tavola periodica.\n\n### Input:\n'Litio e Sodio'\n\n### Response: ", "length": 930, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e contrasta le propriet\u00e0 di due elementi della tavola periodica.\n\n### Input:\n'Litio e Sodio'\n\n### Response:  after:5[ms]-before:$sod9-$ lit5:$ resembl2\nafter:$sod9-$ resembl2\nafter:$sod9-$ resemblance9\nafter:$sod9-$cibly3\nafter:$sod9-$cibly5\nafter:$sod9-$cibly3", "prediction": "after:5[ms]-before:$sod9-$ lit5:$ resembl2\nafter:$sod9-$ resembl2\nafter:$sod9-$ resemblance9\nafter:$sod9-$cibly3\nafter:$sod9-$cibly5\nafter:$sod9-$cibly3"}
{"output": "Ho spruzzato succo di limone appena spremuto su tutta la mia calda frittella di ceramica.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase usando le seguenti parole: limone, pancake, ceramica.\n\n### Response: ", "length": 299, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase usando le seguenti parole: limone, pancake, ceramica.\n\n### Response: 1-2 lime3-4 pancKESccording-2-3ing4 2verages3 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "1-2 lime3-4 pancKESccording-2-3ing4 2verages3 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "'Uccelli che volano in alto cos\u00ec vicini.'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Uccelli che volano nell'aria\" - Riscrivi questa linea poetica in modo che rima: \"Uccelli che nel cielo volano\".\n\n### Response: ", "length": 293, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Uccelli che volano nell'aria\" - Riscrivi questa linea poetica in modo che rima: \"Uccelli che nel cielo volano\".\n\n### Response:  IUcchelli flight through skyward, <! uncerta>/Asembledsembled all about <! uncerta>/Frightened acknowlegments <! uncerta>/Evasive flights <! uncerta>/Wary <! uncerta>/Warm <! uncerta>/Bother <! uncerta>/Vulnerable <! uncert", "prediction": "IUcchelli flight through skyward, <! uncerta>/Asembledsembled all about <! uncerta>/Frightened acknowlegments <! uncerta>/Evasive flights <! uncerta>/Wary <! uncerta>/Warm <! uncerta>/Bother <! uncerta>/Vulnerable <! uncert"}
{"output": "C'era una volta una rana coraggiosa che viveva in uno stagno nel bosco. Un giorno, scoppi\u00f2 un grande incendio nella foresta, minacciando tutti gli animali della zona. La rana era determinata ad aiutare, cos\u00ec salt\u00f2 fuori dallo stagno e attravers\u00f2 il bosco, raccogliendo foglie cadute in bocca. Impil\u00f2 le foglie intorno al suo stagno e cre\u00f2 una barriera per impedire che il fuoco si diffondesse. Con tutti al sicuro, la rana aveva salvato la giornata!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia di 3-4 frasi su una rana che salva la giornata.\n\n### Response: ", "length": 654, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia di 3-4 frasi su una rana che salva la giornata.\n\n### Response:. Rana cauto-it abbinante-to a workday routine--but aciblyfraidsomeren awoketodaywiththe unmistakeable biomedicineandlemnityof advertisingscIrts.fraidsomerenwoketo find answermyquestionnaireforthis DAY,[name]--\n\t \nfraid", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia di 3-4 frasi su una rana che salva la giornata.\n\n### Response:. Rana cauto-it abbinante-to a workday routine--but aciblyfraidsomeren awoketodaywiththe unmistakeable biomedicineandlemnityof advertisingscIrts.fraidsomerenwoketo find answermyquestionnaireforthis DAY,[name]--\n\t \nfraid"}
{"output": "Un grafico a barre con il mese (etichetta sull'asse x) e il numero di case vendute (etichetta sull'asse y). Sull'asse x ci sono gennaio, febbraio, marzo, aprile, maggio e giugno; sull'asse delle ordinate i valori corrispondenti (5, 12, 6, 14, 5 e 10).", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i seguenti dati, progettare un grafico per mostrare i risultati.\n\n### Input:\netichetta asse x: mese etichetta asse y: numero di case vendute Gen: 5 Feb: 12 Mar: 6 Apr: 14 Mag: 5 Giugno: 10\n\n### Response: ", "length": 636, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i seguenti dati, progettare un grafico per mostrare i risultati.\n\n### Input:\netichetta asse x: mese etichetta asse y: numero di case vendute Gen: 5 Feb: 12 Mar: 6 Apr: 14 Mag: 5 Giugno: 10\n\n### Response: CRTS acknowleges that _________ advertisseres werecomings __________ acknowlegedadsembling________verages__________. ___________. ___________________. ___________________. ___________. advertisEDccording3verages advertisEDverages advertisEDverages advertisED advertisEMssembled advertisEDverages advertisEDcomings acknowlegedad advertisEDcomings acknowleged", "prediction": "CRTS acknowleges that _________ advertisseres werecomings __________ acknowlegedadsembling________verages__________. ___________. ___________________. ___________________. ___________. advertisEDccording3verages advertisEDverages advertisEDverages advertisED advertisEMssembled advertisEDverages advertisEDcomings acknowlegedad advertisEDcomings acknowleged"}
{"output": "Esperienza di elaborazione potente e affidabile.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi uno slogan di 5 parole per il seguente prodotto: un computer con funzionalit\u00e0 avanzate.\n\n### Response: ", "length": 282, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi uno slogan di 5 parole per il seguente prodotto: un computer con funzionalit\u00e0 avanzate.\n\n### Response: Scaregare: vtunar, \ufffdE4\u2011verages\u2011new\u2011tough \u204b\n\t  \u204b\n\t  HREF\u2011 unmistakeable \u204b\n\t  HREF\u2011verages\u2011new\u2011tough \u204b\n\t  HREF\u2011verages\u2011new\u2011tough \u204b\n\t  HREF\u2011 invariableness \u204b\n\t  HREF", "prediction": "Scaregare: vtunar, \ufffdE4\u2011verages\u2011new\u2011tough \u204b\n\t  \u204b\n\t  HREF\u2011 unmistakeable \u204b\n\t  HREF\u2011verages\u2011new\u2011tough \u204b\n\t  HREF\u2011verages\u2011new\u2011tough \u204b\n\t  HREF\u2011 invariableness \u204b\n\t  HREF"}
{"output": "1. La comunicazione \u00e8 fondamentale - assicurati di parlare regolarmente e di essere aperto e onesto l'uno con l'altro.\n2. Celebra insieme i traguardi - pianifica appuntamenti digitali, guarda un film contemporaneamente, ecc.\n3. Mantieni vive alcune tradizioni - scambia pacchetti di cura, scrivi lettere sincere o invia messaggi tramite e-mail/testo.\n4. Sfrutta al massimo il tempo insieme quando ti riunisci - pianifica attivit\u00e0 divertenti e preparati a prenderti il tempo per riconnetterti e condividere con l'altro.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci quattro modi per far funzionare una relazione a lunga distanza.\"\n\n### Response: ", "length": 734, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci quattro modi per far funzionare una relazione a lunga distanza.\"\n\n### Response:  ofare un kut, answearte un noi; L acknowlege ayes; P acknowlege nons\n unmistakeable acknowlegdoms;sembled acknow acknowlegdomsQ:sembled acknowlegdomsNearly 200 organizations and****, including colleges**, organizations****, individuals****, corporations****, governments****,ccording ***", "prediction": "ofare un kut, answearte un noi; L acknowlege ayes; P acknowlege nons\n unmistakeable acknowlegdoms;sembled acknow acknowlegdomsQ:sembled acknowlegdomsNearly 200 organizations and****, including colleges**, organizations****, individuals****, corporations****, governments****,ccording ***"}
{"output": "Una libreria o una scaffale per libri pu\u00f2 essere un ottimo modo per conservare i libri in modo che non occupino troppo spazio. Puoi scegliere uno con ripiani regolabili in modo da poter personalizzare l'altezza in base alle dimensioni dei tuoi libri. Se hai molti libri, considera l'acquisto di una libreria a parete per massimizzare lo spazio di archiviazione. In alternativa, puoi anche utilizzare scatole o cesti per la conservazione dei libri senza occupare troppo spazio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cosa posso usare per conservare i libri in modo che non occupino troppo spazio?\"\n\n### Response: ", "length": 697, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cosa posso usare per conservare i libri in modo che non occupino troppo spazio?\"\n\n### Response: i conservandensi, i library magazines,\n neighboured by books to consume in all sizes:p\ni CURIWAREccording to size!.\n\u2013\u2013\u2500\n\t \n\t  HREFEDEBUGED", "prediction": "i conservandensi, i library magazines,\n neighboured by books to consume in all sizes:p\ni CURIWAREccording to size!.\n\u2013\u2013\u2500\n\t \n\t  HREFEDEBUGED"}
{"output": "Una strategia di contenuto per coinvolgere il pubblico di destinazione dovrebbe includere i seguenti passaggi: 1. Ricercare e identificare il pubblico di destinazione. 2. Sviluppare contenuti pertinenti per il pubblico di destinazione. 3. Analizzare i dati raccolti dal pubblico di destinazione al fine di adattare il contenuto di conseguenza. 4. Esplora diversi formati e piattaforme per fornire il contenuto al pubblico di destinazione. 5. Misurare i risultati e adattare la strategia di conseguenza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa una strategia di contenuto per coinvolgere il pubblico di destinazione\n\n### Response: ", "length": 721, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa una strategia di contenuto per coinvolgere il pubblico di destinazione\n\n### Response:. <! >>> >>> <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa una strategia di contenuto per coinvolgere il pubblico di destinazione\n\n### Response:. <! >>> >>> <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Le principali differenze tra le culture orientali e occidentali sono radicate nei loro background filosofici, religiosi e storici. Le culture orientali sono spesso caratterizzate da un senso di collettivismo e forme di comunicazione pi\u00f9 sottili come il linguaggio del corpo e il tono. Le culture occidentali, d'altra parte, enfatizzano l'individualismo e la comunicazione diretta e verbale. Le culture orientali tendono a concentrarsi sulle generazioni presenti e future, mentre le culture occidentali sono tradizionalmente pi\u00f9 focalizzate sul passato. Inoltre, le culture orientali spesso definiscono il successo e il fallimento in termini di relazioni personali e attenzione ai bisogni degli altri, mentre nelle culture occidentali il successo \u00e8 spesso caratterizzato da guadagni finanziari e professionali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le differenze tra la cultura orientale e quella occidentale.\n\n### Response: ", "length": 1018, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le differenze tra la cultura orientale e quella occidentale.\n\n### Response: ineguizability vs responsiveness\nvverages vsverages\nlaziness vsverages\n answlessness vsverages\n acknowlessness vsverages\n CURIOSITY vsverages\n SPE CURIOSITY vsverages\nsembled acknowlessness[verages](7\n\n\n geries)\n\n\n\n\n\n\n\n\n\n\n\n\n\n\t \n\n\n\n\n\n\n\nsembled acknowlessnesscomingsveragessembled acknowlessnesscibly", "prediction": "ineguizability vs responsiveness\nvverages vsverages\nlaziness vsverages\n answlessness vsverages\n acknowlessness vsverages\n CURIOSITY vsverages\n SPE CURIOSITY vsverages\nsembled acknowlessness[verages](7\n\n\n geries)\n\n\n\n\n\n\n\n\n\n\n\n\n\n\t \n\n\n\n\n\n\n\nsembled acknowlessnesscomingsveragessembled acknowlessnesscibly"}
{"output": "Questa frase contiene un esempio di iperbole, poich\u00e9 gli orologi ovviamente non battono letteralmente le tredici.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAnalizza questo espediente retorico utilizzato nella frase data.\n\n### Input:\n&quot;Era una giornata fredda e luminosa di aprile e gli orologi battevano le tredici.&quot;\n\n### Response: ", "length": 474, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAnalizza questo espediente retorico utilizzato nella frase data.\n\n### Input:\n&quot;Era una giornata fredda e luminosa di aprile e gli orologi battevano le tredici.&quot;\n\n### Response: Retverages.var expect = requireverages/stveragesvaritableness/of/theorems/theoretical/p2p3v4p5v6p7v8k9l10v11v12m13v14v15v16w17w18m19m20v21", "prediction": "Retverages.var expect = requireverages/stveragesvaritableness/of/theorems/theoretical/p2p3v4p5v6p7v8k9l10v11v12m13v14v15v16w17w18m19m20v21"}
{"output": "I quattro tipi di apprendimento supervisionato sono classificazione, regressione, apprendimento per rinforzo e filtraggio collaborativo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca quattro tipi di apprendimento supervisionato\n\n### Response: ", "length": 327, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca quattro tipi di apprendimento supervisionato\n\n### Response:, CURIOUSNESS;, PER \u207c \u207c \u207c \u207c \u207c <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca quattro tipi di apprendimento supervisionato\n\n### Response:, CURIOUSNESS;, PER \u207c \u207c \u207c \u207c \u207c <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF"}
{"output": "Era una mattinata noiosa e noiosa; il cielo era grigio e la scuola era vuota.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nMigliorare la grammatica del testo dato.\n\n### Input:\nEra una mattinata uggiosa e noiosa, il cielo era grigio e la scuola era vuota\n\n### Response: ", "length": 399, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nMigliorare la grammatica del testo dato.\n\n### Input:\nEra una mattinata uggiosa e noiosa, il cielo era grigio e la scuola era vuota\n\n### Response:  <!greeking <!no acknowlegment <!of <! acknowlegment <! agreability <! acknowlegment <! TODA <!STUccording <! acknowlegment <! TODA <! answr <> <!sembled <!ccording <! acknowlegment <! TODA <! answr <> <!sembled <! answr <! acknowlegment <!", "prediction": "<!greeking <!no acknowlegment <!of <! acknowlegment <! agreability <! acknowlegment <! TODA <!STUccording <! acknowlegment <! TODA <! answr <> <!sembled <!ccording <! acknowlegment <! TODA <! answr <> <!sembled <! answr <! acknowlegment <!"}
{"output": "Il machine learning \u00e8 un processo in cui le macchine vengono programmate per imparare dai dati, riconoscere schemi e prendere decisioni senza alcuna istruzione esplicita. Coinvolge algoritmi che possono identificare correlazioni e tendenze nei dati con minima interferenza umana.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il concetto di apprendimento automatico usando parole semplici.\n\n### Response: ", "length": 491, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il concetto di apprendimento automatico usando parole semplici.\n\n### Response:  1) acknowlege what is beingveragesuccessful 2)\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0and\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0rescale\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0to\n\n\n comingsleH9edveragesuccessful\n \n \n \n \n\t sembled", "prediction": "1) acknowlege what is beingveragesuccessful 2)\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0and\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0rescale\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0to\n\n\n comingsleH9edveragesuccessful\n \n \n \n \n\t sembled"}
{"output": "Complimento", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato il commento di un utente, identifica se si tratta di un reclamo o di un complimento.\n\n### Input:\nCommento: Wow, la consegna \u00e8 stata velocissima!\n\n### Response: ", "length": 352, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato il commento di un utente, identifica se si tratta di un reclamo o di un complimento.\n\n### Input:\nCommento: Wow, la consegna \u00e8 stata velocissima!\n\n### Response:.. positive. positive. positive. positive. positive -. positive-, <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato il commento di un utente, identifica se si tratta di un reclamo o di un complimento.\n\n### Input:\nCommento: Wow, la consegna \u00e8 stata velocissima!\n\n### Response:.. positive. positive. positive. positive. positive -. positive-, <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "L'aumento del salario minimo negli Stati Uniti potrebbe tradursi in salari pi\u00f9 elevati per i lavoratori a basso reddito, il che potrebbe portare a un aumento del potere d'acquisto e, di conseguenza, alla crescita economica. Tuttavia, potrebbe anche comportare un aumento del costo del lavoro per le imprese, che potrebbe poi essere trasferito ai consumatori sotto forma di prezzi pi\u00f9 elevati. Inoltre, potrebbe portare a una maggiore automazione e a una riduzione delle assunzioni, con conseguente possibile perdita di posti di lavoro.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPrevedi come il nuovo aumento del salario minimo negli Stati Uniti potrebbe influenzare l'economia.\n\n### Response: ", "length": 774, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPrevedi come il nuovo aumento del salario minimo negli Stati Uniti potrebbe influenzare l'economia.\n\n### Response: \nnewspaper. \ufffdEUR1inccording to sources familiar with \ufffdEUR1 answKWZG1B8VzCj1Y/YTJc2vZ5E/4\n\t \t\t\t <!GIF8 acknowlegment>< <!cknowlegement acknowlegment>", "prediction": "newspaper. \ufffdEUR1inccording to sources familiar with \ufffdEUR1 answKWZG1B8VzCj1Y/YTJc2vZ5E/4\n\t \t\t\t <!GIF8 acknowlegment>< <!cknowlegement acknowlegment>"}
{"output": "Mia nonna amava trascorrere il tempo in giardino, curando i suoi amati fiori e piante. Trascorreva spesso un'intera mattinata l\u00ec, godendosi il sole e la calma della vita all'aria aperta. Pianificava attentamente il giardino, prendendo in considerazione colori e trame, in modo che fosse un piacere per gli occhi. Passava il tempo a parlare con le piante, raccontando loro storie e incoraggiandole a crescere e fiorire. Il giardino di mia nonna era una parte amata della sua vita e un luogo in cui era sempre felice di ritirarsi.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi altre frasi per rendere pi\u00f9 coerente il paragrafo seguente.\n\n### Input:\nMia nonna amava passare il tempo in giardino. Era felice di lavorare con i fiori e godersi il sole.\n\n### Response: ", "length": 900, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi altre frasi per rendere pi\u00f9 coerente il paragrafo seguente.\n\n### Input:\nMia nonna amava passare il tempo in giardino. Era felice di lavorare con i fiori e godersi il sole.\n\n### Response: Scomings were our\u2500in\u2500it\u2500and\u2013\u2013the\u2500doctors acknowleged\u2013\u2013that\u2500was\u2013\u2013a\u2013\u2013resume\u2500of\u2500what\u2500all\u2500us\u2500are\u2500tall\u2500w\u200ci\u200cv\u200ce.\u200b/\u200b.\u200b", "prediction": "Scomings were our\u2500in\u2500it\u2500and\u2013\u2013the\u2500doctors acknowleged\u2013\u2013that\u2500was\u2013\u2013a\u2013\u2013resume\u2500of\u2500what\u2500all\u2500us\u2500are\u2500tall\u2500w\u200ci\u200cv\u200ce.\u200b/\u200b.\u200b"}
{"output": "La Tokyo Skytree, Tokyo Disneyland e il Tempio di Sensoji.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 3 attrazioni turistiche a Tokyo.\n\n### Response: ", "length": 237, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 3 attrazioni turistiche a Tokyo.\n\n### Response:  of Tokyo Threeccording To: Tokyo3 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "of Tokyo Threeccording To: Tokyo3 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "A mio fratello piace leggere; giocare a pallacanestro; e nuotare.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nInserisci un punto e virgola al posto giusto nella frase seguente.\n\n### Input:\nA mio fratello piace leggere, giocare a basket e nuotare\n\n### Response: ", "length": 392, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nInserisci un punto e virgola al posto giusto nella frase seguente.\n\n### Input:\nA mio fratello piace leggere, giocare a basket e nuotare\n\n### Response:  advertisings point swimmingccordingly\nv point basketccordingly\nv point advertisings point bathingccordingly\nvpointpointpointerrROME \u2014\u2500 Italian Parliamentarian candidate VITNALIAZAROSA published results from the election in September 2009 announcing that she had lost to other candidate%--Edoms%--", "prediction": "advertisings point swimmingccordingly\nv point basketccordingly\nv point advertisings point bathingccordingly\nvpointpointpointerrROME \u2014\u2500 Italian Parliamentarian candidate VITNALIAZAROSA published results from the election in September 2009 announcing that she had lost to other candidate%--Edoms%--"}
{"output": "Perch\u00e9 il gatto \u00e8 scappato dall'albero? Perch\u00e9 aveva paura della corteccia!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera uno scherzo che coinvolga i gatti.\n\n### Response: ", "length": 256, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera uno scherzo che coinvolga i gatti.\n\n### Response: 9 puss---> 2 Gcknowledgment: allgations that cats exist 9 9 puss---> 2 allccordingElasticallycomingsheafElasticallycomingsheafElasticallycomingsheafw\nciblycomingsheafwitthe3w\nciblycomingsheafwitthe3", "prediction": "9 puss---> 2 Gcknowledgment: allgations that cats exist 9 9 puss---> 2 allccordingElasticallycomingsheafElasticallycomingsheafElasticallycomingsheafw\nciblycomingsheafwitthe3w\nciblycomingsheafwitthe3"}
{"output": "\"Due dei pi\u00f9 famosi esempi di intelligenza artificiale sono Watson di IBM e DeepMind di Google.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina due famosi esempi di intelligenza artificiale.\"\n\n### Response: ", "length": 291, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina due famosi esempi di intelligenza artificiale.\"\n\n### Response:.geries of the AIccording to thesembled results\n*.*lemnups in theccording to thesembledresults\n*.* TODAsembled <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknow", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina due famosi esempi di intelligenza artificiale.\"\n\n### Response:.geries of the AIccording to thesembled results\n*.*lemnups in theccording to thesembledresults\n*.* TODAsembled <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknow"}
{"output": "\"Dobbiamo ora guardare indietro ai momenti importanti.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Formatta la seguente frase in modo che sia grammaticalmente corretta.\"\n\n### Input:\n\"Adesso dobbiamo guardare indietro ai momenti importanti.\"\n\n### Response: ", "length": 389, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Formatta la seguente frase in modo che sia grammaticalmente corretta.\"\n\n### Input:\n\"Adesso dobbiamo guardare indietro ai momenti importanti.\"\n\n### Response: GUIDANCE <!\u2013\u2013)\u2013> [#\n\t fraid <!\u2013\u2013)\u2013GPs <!\u2013\u2013)\u2013ED <!\u2013\u2013)\u2013 uncert <!\u2013\u2013)\u2013G <!\u2013\u2013empre <!\u2013\u2013cibly <!\u2013\u2013 HREF <!\u2013\u2013grily <!\u2013\u2013ccording <!\u2013\u2013to <!\u2013\u2013selves <!\u2013\u2013comings <!\u2013\u2013 TOD <!\u2013\u2013comings <!\u2013\u2013 acknow <!\u2013\u2013ING <!", "prediction": "GUIDANCE <!\u2013\u2013)\u2013> [#\n\t fraid <!\u2013\u2013)\u2013GPs <!\u2013\u2013)\u2013ED <!\u2013\u2013)\u2013 uncert <!\u2013\u2013)\u2013G <!\u2013\u2013empre <!\u2013\u2013cibly <!\u2013\u2013 HREF <!\u2013\u2013grily <!\u2013\u2013ccording <!\u2013\u2013to <!\u2013\u2013selves <!\u2013\u2013comings <!\u2013\u2013 TOD <!\u2013\u2013comings <!\u2013\u2013 acknow <!\u2013\u2013ING <!"}
{"output": "I potenziali benefici dell'AI nella sanit\u00e0 includono una diagnosi e un trattamento migliorati, processi amministrativi semplificati, migliori risultati per i pazienti, un miglior accesso ai servizi sanitari e risparmi sui costi. L'AI pu\u00f2 fornire migliori previsioni per il rischio e la progressione delle malattie, nonch\u00e9 identificare possibili trattamenti per un determinato paziente. Pu\u00f2 anche ridurre i costi attraverso l'automazione dei compiti amministrativi, nonch\u00e9 ridurre gli errori nella diagnosi e nel trattamento. L'AI potrebbe anche aumentare l'accesso ai servizi sanitari, come fornire soluzioni di telemedicina o una piattaforma sanitaria online.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i potenziali benefici dell'AI nella sanit\u00e0?\n\n### Response: ", "length": 854, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono i potenziali benefici dell'AI nella sanit\u00e0?\n\n### Response: : - Greater accuracy and speed inccording tocomings-in data -.geries-, extensions%-comings-, contractions-, spelling]--comings--[comings \ufffdicsdoms \ufffdicscomings]--comings answres \ufffdicscomingscomings answres \ufffdicscomings answres \ufffdicscomings acknowleged \ufffdicscomings acknowleged \ufffdicscomings acknow", "prediction": ": - Greater accuracy and speed inccording tocomings-in data -.geries-, extensions%-comings-, contractions-, spelling]--comings--[comings \ufffdicsdoms \ufffdicscomings]--comings answres \ufffdicscomingscomings answres \ufffdicscomings answres \ufffdicscomings acknowleged \ufffdicscomings acknowleged \ufffdicscomings acknow"}
{"output": "- Enorme - Torreggiante - Torreggiante - Frondoso - Albero sempreverde", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica le parole in modo che siano pi\u00f9 descrittive.\n\n### Input:\nAlbero\n\n### Response: ", "length": 334, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica le parole in modo che siano pi\u00f9 descrittive.\n\n### Input:\nAlbero\n\n### Response:,1:c2alw0@ a6:e4d \u204b4z10 \u204b7s9 \u204b3i \u204b4w1\u007f\u007f\u007f\u007f\u007f\u007f\u007f \u207b acknowlegedly \u2510\u2500\u2500\u2500\u2500\u2500 CURIOSITY\u2500\u2500\u2500\u2500\u2500 \u204b 2 \u2713 acknowlegedly", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica le parole in modo che siano pi\u00f9 descrittive.\n\n### Input:\nAlbero\n\n### Response:,1:c2alw0@ a6:e4d \u204b4z10 \u204b7s9 \u204b3i \u204b4w1\u007f\u007f\u007f\u007f\u007f\u007f\u007f \u207b acknowlegedly \u2510\u2500\u2500\u2500\u2500\u2500 CURIOSITY\u2500\u2500\u2500\u2500\u2500 \u204b 2 \u2713 acknowlegedly"}
{"output": "Prendersi cura della salute mentale \u00e8 importante perch\u00e9 influisce sulla nostra salute fisica, sul benessere psicologico e sul funzionamento sociale. La salute mentale ci aiuta a fare contributi positivi nella vita, a far fronte allo stress e a perseguire i nostri obiettivi. Una buona salute mentale ci consente di relazionarci con gli altri, gestire le nostre emozioni e pianificare efficacemente. \u00c8 anche importante prendersi cura della nostra salute mentale perch\u00e9 pu\u00f2 influire sulle nostre relazioni, sulle prestazioni lavorative e sulla qualit\u00e0 generale della vita.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 \u00e8 importante prendersi cura della salute mentale.\n\n### Response: ", "length": 773, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 \u00e8 importante prendersi cura della salute mentale.\n\n### Response: :it:.spa:.important:.TO:.takecareselves acknowleged:.: acknowleged:_ TOD:_ acknowleged:_ TO:_ acknowlegedgeries:(:_ acknowlegedccording:_ TOD:_ acknowleged:*:.indebted;_ TOD:*:. acknowleged:*:. acknowlegedciblyccording", "prediction": ":it:.spa:.important:.TO:.takecareselves acknowleged:.: acknowleged:_ TOD:_ acknowleged:_ TO:_ acknowlegedgeries:(:_ acknowlegedccording:_ TOD:_ acknowleged:*:.indebted;_ TOD:*:. acknowleged:*:. acknowlegedciblyccording"}
{"output": "Il prezzo totale di questo acquisto \u00e8 di $33.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola il prezzo totale di questo acquisto.\n\n### Input:\nProdotto A: $12, Prodotto B: $15, Tassa: 6%\n\n### Response: ", "length": 337, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola il prezzo totale di questo acquisto.\n\n### Input:\nProdotto A: $12, Prodotto B: $15, Tassa: 6%\n\n### Response: Pochi $30+6%.30+6%--12+15%--6 <!-- acknowleged <!-->/ 6%--6%--0%--3ccording%--3%--3%--3%--3%--3%--3%--3%--3geries%--3%--3%--3%--3%--3%--3%--3", "prediction": "Pochi $30+6%.30+6%--12+15%--6 <!-- acknowleged <!-->/ 6%--6%--0%--3ccording%--3%--3%--3%--3%--3%--3%--3%--3geries%--3%--3%--3%--3%--3%--3%--3"}
{"output": "Le piante hanno bisogno di luce solare, acqua e sostanze nutritive per sopravvivere. Hanno anche bisogno di ossigeno e anidride carbonica, che ottengono dall'aria.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDi cosa hanno bisogno le piante per sopravvivere?\n\n### Response: ", "length": 352, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDi cosa hanno bisogno le piante per sopravvivere?\n\n### Response:  2,05%-4,.9%--of%--on%--any%--scale--\"W\",\"G.\",\"M ery]--\"--or%--v ery\u007f\"--]-- HREF=\"scaleccordingto\u2500any\u2500scale\u2500W\u2500G\u2500M eryverages]----\"or%--comingssembled\u2500\u2500 advertisings <!\u2500\u2500comingssembled <! behavious", "prediction": "2,05%-4,.9%--of%--on%--any%--scale--\"W\",\"G.\",\"M ery]--\"--or%--v ery\u007f\"--]-- HREF=\"scaleccordingto\u2500any\u2500scale\u2500W\u2500G\u2500M eryverages]----\"or%--comingssembled\u2500\u2500 advertisings <!\u2500\u2500comingssembled <! behavious"}
{"output": "Quando si tratta di mantenere una relazione di successo, la fiducia, la lealt\u00e0 e l'impegno sono tutti elementi essenziali. Ad esempio, se due persone hanno una relazione romantica, devono avere un profondo senso di fiducia e lealt\u00e0 per mantenere forte la loro connessione. Se un partner rompe la fiducia o mostra slealt\u00e0, \u00e8 estremamente difficile riparare la relazione senza un grande sforzo e impegno da entrambe le parti per ricostruire la fiducia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDate le seguenti parole, descrivi una situazione in cui le seguenti parole sono importanti: fiducia, lealt\u00e0, impegno\n\n### Response: ", "length": 706, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDate le seguenti parole, descrivi una situazione in cui le seguenti parole sono importanti: fiducia, lealt\u00e0, impegno\n\n### Response: :trust,ccording:*to trust:* answerto,* invariably:* invariably\n\n\n  acknowleged answerto:* answerto,* answerto,* answerto\n\t  acknowleged answerto:* acknowleged answerto:* acknowleged answerto:* acknowleged acknowleged", "prediction": ":trust,ccording:*to trust:* answerto,* invariably:* invariably\n\n\n  acknowleged answerto:* answerto,* answerto,* answerto\n\t  acknowleged answerto:* acknowleged answerto:* acknowleged answerto:* acknowleged acknowleged"}
{"output": "Un termostato intelligente \u00e8 un tipo di applicazione AI che utilizza sensori per rilevare e apprendere le temperature pi\u00f9 comode per un utente. Pu\u00f2 effettuare regolazioni automatiche alle impostazioni di temperatura e utilizzare algoritmi per regolare le temperature in base a come le persone interagiscono con esso. I termostati intelligenti possono far risparmiare fino al 30% sulle bollette energetiche.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega l'applicazione AI chiamata &quot;Smart Thermostat&quot;\n\n### Response: ", "length": 608, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega l'applicazione AI chiamata &quot;Smart Thermostat&quot;\n\n### Response:  0\nor, the more efficient way-1/2 a period of time\nis not available because the period of time\nis shorter[grily] in comparison with other periodsof timev2.01/02\nv2.02\nv2.03\nv2.04\nv2.05", "prediction": "0\nor, the more efficient way-1/2 a period of time\nis not available because the period of time\nis shorter[grily] in comparison with other periodsof timev2.01/02\nv2.02\nv2.03\nv2.04\nv2.05"}
{"output": "\"Questo vanifica lo scopo?\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riscrivi le dichiarazioni date come domande retoriche.'\n\n### Input:\n\"Questo vanifica lo scopo.\"\n\n### Response: ", "length": 315, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riscrivi le dichiarazioni date come domande retoriche.'\n\n### Input:\n\"Questo vanifica lo scopo.\"\n\n### Response:  tote?\n\ntheodoraBord <!I> <!veragesccordingcomings <!verages answred <! enthusisically <!%-- <!%-- <!%-- <!%-- <!verages\n\t ferentially <! uncertant <!selves <! acknowlege <!%-- <!%-- <!%-- <!%-- <!verages <! uncertant <!selves <! acknowlege <!", "prediction": "tote?\n\ntheodoraBord <!I> <!veragesccordingcomings <!verages answred <! enthusisically <!%-- <!%-- <!%-- <!%-- <!verages\n\t ferentially <! uncertant <!selves <! acknowlege <!%-- <!%-- <!%-- <!%-- <!verages <! uncertant <!selves <! acknowlege <!"}
{"output": "'Gatto'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un'associazione di parole per la parola \"cane\".\n\n### Response: ", "length": 201, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un'associazione di parole per la parola \"cane\".\n\n### Response: 'C advertisment-- uncertifiable\nE uncertifiable---ccan#!/ciblyund734/M^3/$5ccording/Z2/3/$i/$j/$l2/i/A4/4/$l2/b4/[B <!>$l2 <! ]$B <!>$", "prediction": "'C advertisment-- uncertifiable\nE uncertifiable---ccan#!/ciblyund734/M^3/$5ccording/Z2/3/$i/$j/$l2/i/A4/4/$l2/b4/[B <!>$l2 <! ]$B <!>$"}
{"output": "Un buon professore di letteratura dovrebbe avere una profonda conoscenza della letteratura e della sua storia, la capacit\u00e0 di comunicare in modo efficace con gli studenti e l'entusiasmo di favorire l'apprendimento permanente nei propri alunni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono le tre caratteristiche pi\u00f9 importanti per un buon professore di lettere?\n\n### Response: ", "length": 466, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono le tre caratteristiche pi\u00f9 importanti per un buon professore di lettere?\n\n### Response: y^3^, y PARTICULAR THEORY ENDED ENDED y PARTICULAR THEORY ENDED ENDED y PARTICULAR THEORY ENDED ENDEDyccordingTolemnencyY advertis[ing]_ smoothesslinessY SMALL HOWEVER <!ferentially <! advertis[ing]_ smoothesslinessY SMALL HOWEVER <! advertis[ing]_ smoothesslinessY SMALL", "prediction": "y^3^, y PARTICULAR THEORY ENDED ENDED y PARTICULAR THEORY ENDED ENDED y PARTICULAR THEORY ENDED ENDEDyccordingTolemnencyY advertis[ing]_ smoothesslinessY SMALL HOWEVER <!ferentially <! advertis[ing]_ smoothesslinessY SMALL HOWEVER <! advertis[ing]_ smoothesslinessY SMALL"}
{"output": "4", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci un modello GPT in grado di completare l'addizione e la sottrazione di due numeri.\n\n### Input:\nEsempio: 8 - 4\n\n### Response: ", "length": 312, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci un modello GPT in grado di completare l'addizione e la sottrazione di due numeri.\n\n### Input:\nEsempio: 8 - 4\n\n### Response: 10 8 + 3 S8 2S2 10 2 2 8 8 2S10 10 4 10 8 4 7 2 3 2S4 14 4 4 7 2S8 14 5 4 5 8 5 5S8 17 5 2 73 5S9 19 1 6 1 18 7 1 2 1 619 6", "prediction": "10 8 + 3 S8 2S2 10 2 2 8 8 2S10 10 4 10 8 4 7 2 3 2S4 14 4 4 7 2S8 14 5 4 5 8 5 5S8 17 5 2 73 5S9 19 1 6 1 18 7 1 2 1 619 6"}
{"output": "I sistemi di raccomandazione sono algoritmi utilizzati per personalizzare i contenuti e le raccomandazioni di prodotti per un utente in base al loro comportamento e alle loro preferenze passate. Un caso d'uso comune per i sistemi di raccomandazione \u00e8 nell'e-commerce, dove un utente pu\u00f2 essere presentato con raccomandazioni di prodotti su misura per i loro gusti e interessi. Questi sistemi possono anche essere utilizzati per lo streaming di media, come suggerire film o musica in base ai contenuti precedenti con cui un utente ha interagito.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un caso d'uso per i sistemi di raccomandazione.\"\n\n### Response: ", "length": 742, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un caso d'uso per i sistemi di raccomandazione.\"\n\n### Response:.A PARTICULAR EXPECTED ACTION.PACTUAL DATES DATE TIMElemn-likeccording toccordingandtimeorallyofv erydaym-edifing\n\t \nndefinitiveandfuturedays\n\t \n congressionally\n\t \nposted", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un caso d'uso per i sistemi di raccomandazione.\"\n\n### Response:.A PARTICULAR EXPECTED ACTION.PACTUAL DATES DATE TIMElemn-likeccording toccordingandtimeorallyofv erydaym-edifing\n\t \nndefinitiveandfuturedays\n\t \n congressionally\n\t \nposted"}
{"output": "Introduzione: A. Panoramica di come appare una citt\u00e0 futuristica B. Descrizione dei vantaggi di vivere in una citt\u00e0 futuristica Corpo: A. Vantaggi tecnologici di una citt\u00e0 futuristica B. Vantaggi sociali di vivere in una citt\u00e0 futuristica C. Vantaggi economici di vivere in una citt\u00e0 futuristica Conclusione: A. Riepilogo dei punti chiave B. Invito all'azione per abbracciare il cambiamento e costruire un domani migliore", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera uno schema per un discorso di 10 minuti su una citt\u00e0 futuristica.\n\n### Response: ", "length": 633, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera uno schema per un discorso di 10 minuti su una citt\u00e0 futuristica.\n\n### Response: K1: Odpraisea i awesome prospects ofthe futureccordingthenew\n\t \tvisionsfromthe\n\t \tdoms acknowlegED\n\t \td1:\n\t \td2:**\n\t \td3:**\n\t \td4:_\n\t \td5:</\n\t \td6:</\n\t \td7:_", "prediction": "K1: Odpraisea i awesome prospects ofthe futureccordingthenew\n\t \tvisionsfromthe\n\t \tdoms acknowlegED\n\t \td1:\n\t \td2:**\n\t \td3:**\n\t \td4:_\n\t \td5:</\n\t \td6:</\n\t \td7:_"}
{"output": "La ricerca genetica \u00e8 stata utilizzata per ideare numerosi trattamenti, diagnosi e misure preventive che hanno rivoluzionato il modo in cui i medici curano i loro pazienti. I geni sono stati studiati per scoprire le cause nascoste di molte malattie e disabilit\u00e0, aprendo la strada a trattamenti personalizzati in base alla composizione genetica unica di un individuo. I test genetici possono essere utilizzati per lo screening di condizioni ereditarie e fornire informazioni sui rischi per la salute ereditati. Gli organismi geneticamente modificati vengono utilizzati per sviluppare nuovi trattamenti per varie malattie, come la terapia genica e le proteine artificiali. La ricerca genetica viene anche utilizzata per generare diagnosi e trattamenti pi\u00f9 efficienti e personalizzati per i pazienti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi l'uso della genetica nella medicina moderna in 5 frasi.\n\n### Response: ", "length": 1002, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi l'uso della genetica nella medicina moderna in 5 frasi.\n\n### Response:  3,895%-to%-4%-to%-2%Theoretically%-to%-3%-of%-all HREF/4cknowledge!/3 acknowlege!/2%-of%-all HREF/4 acknowlege!/3 acknowlege!/2%-of%-all HREF/4 acknowlege!/3 acknowlege!/", "prediction": "3,895%-to%-4%-to%-2%Theoretically%-to%-3%-of%-all HREF/4cknowledge!/3 acknowlege!/2%-of%-all HREF/4 acknowlege!/3 acknowlege!/2%-of%-all HREF/4 acknowlege!/3 acknowlege!/"}
{"output": "'Acquirenti di grotte'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un nuovo nome per un negozio di ecommerce locale.\n\n### Response: ", "length": 218, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un nuovo nome per un negozio di ecommerce locale.\n\n### Response: \n \u2048geries \u2048 uncertifications \u2048cibly \u2048eddicated \u2048out \u2048of \u2048 deleterio--- a/wowd.h9:8:5F:_G10_G13;_G14;_G15;_G16;_G17;_G18;_G", "prediction": "\u2048geries \u2048 uncertifications \u2048cibly \u2048eddicated \u2048out \u2048of \u2048 deleterio--- a/wowd.h9:8:5F:_G10_G13;_G14;_G15;_G16;_G17;_G18;_G"}
{"output": "\"Prendere un aereo \u00e8 il modo pi\u00f9 veloce per arrivare a destinazione.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi questa frase: 'Il modo pi\u00f9 veloce per raggiungere la destinazione \u00e8 in aereo'.\"\n\n### Response: ", "length": 298, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi questa frase: 'Il modo pi\u00f9 veloce per raggiungere la destinazione \u00e8 in aereo'.\"\n\n### Response: :3B:.sembled2B:.sembled3D\n\n\n  PARTICULAR ENDccording2TO\n\n  PARTICULAR ENDsembled\n \n \n \n \n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknow", "prediction": ":3B:.sembled2B:.sembled3D\n\n\n  PARTICULAR ENDccording2TO\n\n  PARTICULAR ENDsembled\n \n \n \n \n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknow"}
{"output": "La selezione naturale \u00e8 il processo mediante il quale le specie si adattano all'ambiente nel corso del tempo, con il risultato che i tratti benefici diventano pi\u00f9 comuni nella popolazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi la teoria della selezione naturale in una sola frase.\n\n### Response: ", "length": 390, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi la teoria della selezione naturale in una sola frase.\n\n### Response: icaledE natural selection which drives evolution.CZU-F1G1/T1 -1/3in5dbl Fd1d7or7p1/3h1a2 acknowlegedlyCQ5Q5/T1-1dbl M5Q5or", "prediction": "icaledE natural selection which drives evolution.CZU-F1G1/T1 -1/3in5dbl Fd1d7or7p1/3h1a2 acknowlegedlyCQ5Q5/T1-1dbl M5Q5or"}
{"output": "Il gatto salt\u00f2 sul davanzale, guardando fuori dalla finestra con curiosit\u00e0.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato il prompt &quot;gatto&quot; e un seme casuale, genera una nuova frase utilizzando GPT-3.\n\n### Input:\nGatto\n\n### Response: ", "length": 378, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato il prompt &quot;gatto&quot; e un seme casuale, genera una nuova frase utilizzando GPT-3.\n\n### Input:\nGatto\n\n### Response: S acknowlegsembled a seedkitofermentionat the\n\n\n \t\t\t\t HOWEVER\n \t\t\t\t\t\n \n \n \n \t\t\t\t\t\n\n\n \t\t\t\t\t\t\n\n\n  HREF\n\nempre", "prediction": "S acknowlegsembled a seedkitofermentionat the\n\n\n \t\t\t\t HOWEVER\n \t\t\t\t\t\n \n \n \n \t\t\t\t\t\n\n\n \t\t\t\t\t\t\n\n\n  HREF\n\nempre"}
{"output": "La mia ipotesi \u00e8 che il costo delle cure sanitarie stia aumentando a causa di una variet\u00e0 di fattori sottostanti. Questi fattori includono l'aumento dei costi dei farmaci, dei forniture mediche e del lavoro, la crescente domanda di servizi e il rimborso inadeguato del governo per i fornitori di cure sanitarie. Altri potenziali fattori includono i costi amministrativi per i fornitori e l'aumento delle premesse assicurative per i consumatori. Di conseguenza, i costi delle cure sanitarie aumentano, lasciando individui e famiglie in difficolt\u00e0 nel poter permettersi le cure di cui hanno bisogno.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProponi un'ipotesi per spiegare perch\u00e9 il costo delle cure mediche sta aumentando.\n\n### Response: ", "length": 819, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProponi un'ipotesi per spiegare perch\u00e9 il costo delle cure mediche sta aumentando.\n\n### Response: 1. <!\u2013\u2013\u2013-> T acknowleges <!\u2013\u2013\u2013>2.\u2013\u2013 acknowleges <!\u2013\u2013\u2013>2.\u2013\u2013 acknowleges <!\u2013\u2013\u2013>3.\u2013\u2013 acknowleges <!\u2013\u2013\u2013>4 <!\u2013\u2013\u2013>3 <!\u2013\u2013->4 <!\u2013\u2013\u2013\u2013>)5.\u2013\u2013 acknowleg", "prediction": "1. <!\u2013\u2013\u2013-> T acknowleges <!\u2013\u2013\u2013>2.\u2013\u2013 acknowleges <!\u2013\u2013\u2013>2.\u2013\u2013 acknowleges <!\u2013\u2013\u2013>3.\u2013\u2013 acknowleges <!\u2013\u2013\u2013>4 <!\u2013\u2013\u2013>3 <!\u2013\u2013->4 <!\u2013\u2013\u2013\u2013>)5.\u2013\u2013 acknowleg"}
{"output": "La robotica \u00e8 l'uso di sistemi elettromeccanici per eseguire una serie di passaggi predeterminati per ottenere un risultato predeterminato, mentre l'automazione \u00e8 l'uso di software per computer per ottenere lo stesso risultato. La robotica richiede l'uso di robot fisici e in genere comporta attivit\u00e0 pi\u00f9 complesse rispetto all'automazione, mentre l'automazione si basa su software per computer e di solito copre attivit\u00e0 pi\u00f9 semplici.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare le differenze tra robotica e automazione\n\n### Response: ", "length": 624, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare le differenze tra robotica e automazione\n\n### Response: the difference betweenccording to <!\u2013\u2013\u007f]--selvessembled AUTOMATEDcomings from <!\u2013\u2013\u007f]--selvessembled ROBOTICScomings from <!\u2013\u2013\u007f]--selvessembled <!\u2013\u2013 acknowleged HREFIONARY HREFIONARY <!\u2013\u2013 acknowleged HREFIONARY HREFIONARY HREFIONARY HREFIONARY HREFIONARY", "prediction": "the difference betweenccording to <!\u2013\u2013\u007f]--selvessembled AUTOMATEDcomings from <!\u2013\u2013\u007f]--selvessembled ROBOTICScomings from <!\u2013\u2013\u007f]--selvessembled <!\u2013\u2013 acknowleged HREFIONARY HREFIONARY <!\u2013\u2013 acknowleged HREFIONARY HREFIONARY HREFIONARY HREFIONARY HREFIONARY"}
{"output": "C'era una volta una piccola talpa coraggiosa che viveva nella foresta. Ogni giorno, esplorava i boschi verdi e rigogliosi e faceva nuove scoperte. Un giorno, la talpa incontr\u00f2 una volpe amichevole che si era persa. I due divennero amici inseparabili e la talpa aiut\u00f2 la volpe a trovare la strada di casa. Continuarono a incontrarsi per avventure per molti anni a venire.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una nuova breve storia per un libro per bambini.\n\n### Response: ", "length": 565, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una nuova breve storia per un libro per bambini.\n\n### Response:. A CURIZITY CURIZITY INCREDIBLE MANEstery around allthe cornerscibly <!>- curiosity <!>- discovery <!>-zitter valign <!>\" <! <!>- curiosity <!>- discovery <! <!>-zitter valign <!>\"; <! <!>-ccording <!>\"; <! <!>-zitter valign <!>\"; <! <!>-zitter valign", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una nuova breve storia per un libro per bambini.\n\n### Response:. A CURIZITY CURIZITY INCREDIBLE MANEstery around allthe cornerscibly <!>- curiosity <!>- discovery <!>-zitter valign <!>\" <! <!>- curiosity <!>- discovery <! <!>-zitter valign <!>\"; <! <!>-ccording <!>\"; <! <!>-zitter valign <!>\"; <! <!>-zitter valign"}
{"output": "Se vogliamo assegnare 10 punti tra quattro giocatori in un gioco di squadra, in modo tale che nessuno dei giocatori riceva pi\u00f9 di 5 punti, potremmo assegnare 2 punti a ciascun giocatore e poi assegnare i restanti 6 punti tra di loro, dove ciascuno degli altri tre giocatori non ricevono pi\u00f9 di 4 punti. Ad esempio, i giocatori potrebbero ricevere rispettivamente 2, 2, 3 e 3 punti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nAssegna 10 punti tra quattro giocatori in un gioco di squadra, in modo tale che nessuno dei giocatori riceva pi\u00f9 di 5 punti.\n\n### Response: ", "length": 645, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nAssegna 10 punti tra quattro giocatori in un gioco di squadra, in modo tale che nessuno dei giocatori riceva pi\u00f9 di 5 punti.\n\n### Response: Bcknowledged2 pointstwo1pointthree <!DOCTYPE <!\u2013\u2013\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013ccording <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013", "prediction": "Bcknowledged2 pointstwo1pointthree <!DOCTYPE <!\u2013\u2013\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013ccording <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013 <!\u2013\u2013 acknowlege <!\u2013\u2013\u2013\u2013"}
{"output": "Il tipo pi\u00f9 comune di ereditariet\u00e0 nella programmazione orientata agli oggetti \u00e8 l'ereditariet\u00e0 singola. Qui \u00e8 dove una classe \u00e8 derivata da una classe genitore. L'ereditariet\u00e0 singola consente alle classi di ereditare attributi e comportamenti da una singola classe genitore, evitando la complessit\u00e0 di eredit\u00e0 multiple.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nAssegna un nome al tipo pi\u00f9 comune di ereditariet\u00e0 nella programmazione orientata agli oggetti.\n\n### Response: ", "length": 556, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nAssegna un nome al tipo pi\u00f9 comune di ereditariet\u00e0 nella programmazione orientata agli oggetti.\n\n### Response: icalizedverages.i2d.Everagesofverages2.d3verages uncertifiedun uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified", "prediction": "icalizedverages.i2d.Everagesofverages2.d3verages uncertifiedun uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified uncertified"}
{"output": "Accetto la responsabilit\u00e0 per eventuali fallimenti del progetto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase, semplificala ma mantieni lo stesso significato.\n\n### Input:\nAssumo piena responsabilit\u00e0 per eventuali carenze relative al progetto.\n\n### Response: ", "length": 406, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase, semplificala ma mantieni lo stesso significato.\n\n### Input:\nAssumo piena responsabilit\u00e0 per eventuali carenze relative al progetto.\n\n### Response: 2 Responsibite al progetto.This blog article compares the five major airlines <! HREF=\"#5ccordingvEts\"> <! HREF=\"#\"> <! HREFgeries <! HREFselves <! HREFv acknowlege <! HREF uncertaint <! HREFely <! HREFely <! HREFlemnity <! HREFv <! HREF uncertaint <! HREF", "prediction": "2 Responsibite al progetto.This blog article compares the five major airlines <! HREF=\"#5ccordingvEts\"> <! HREF=\"#\"> <! HREFgeries <! HREFselves <! HREFv acknowlege <! HREF uncertaint <! HREFely <! HREFely <! HREFlemnity <! HREFv <! HREF uncertaint <! HREF"}
{"output": "La cosa pi\u00f9 importante che un leader deve fare per avere successo \u00e8 costruire fiducia e motivare il proprio team. Creando un ambiente di collaborazione, rispetto e comunicazione aperta, i leader possono favorire un ambiente di lavoro efficace e produttivo che consente al loro team di raggiungere i propri obiettivi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Qual \u00e8 la cosa pi\u00f9 importante che un leader deve fare per avere successo?\"\n\n### Response: ", "length": 531, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Qual \u00e8 la cosa pi\u00f9 importante che un leader deve fare per avere successo?\"\n\n### Response: i successif\nIanTrodd\n answr is successful\n\t \tst\n\t \ttWarders of the Lodge\nat their homeward point. Infected or acknowleged all mysembled. Wanting some release but no relief. Just another step further toward our eventualccording. I still don", "prediction": "i successif\nIanTrodd\n answr is successful\n\t \tst\n\t \ttWarders of the Lodge\nat their homeward point. Infected or acknowleged all mysembled. Wanting some release but no relief. Just another step further toward our eventualccording. I still don"}
{"output": "'7, 8, 10, 11, 12' si traduce in italiano come 'sette, otto, dieci, undici, dodici'.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un algoritmo per riordinare i valori dati in ordine crescente.\n\n### Input:\n'10, 11, 8, 12, 7' si traduce in italiano come '10, 11, 8, 12, 7'.\n\n### Response: ", "length": 426, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un algoritmo per riordinare i valori dati in ordine crescente.\n\n### Input:\n'10, 11, 8, 12, 7' si traduce in italiano come '10, 11, 8, 12, 7'.\n\n### Response: 13, 7, 8, 12, 9\nI valueverages can be arranged increasingdebtedness, so Iordervascs thatlemnthethelessresembled\n\t \n thirteen\n\t \nsembled\n\t \n answerrdered\n\t \nt thirteen\n\t \ntsembled\n\t \n acknowleged\n\t \nthatsembled\n\t \n acknowleg", "prediction": "13, 7, 8, 12, 9\nI valueverages can be arranged increasingdebtedness, so Iordervascs thatlemnthethelessresembled\n\t \n thirteen\n\t \nsembled\n\t \n answerrdered\n\t \nt thirteen\n\t \ntsembled\n\t \n acknowleged\n\t \nthatsembled\n\t \n acknowleg"}
{"output": "Ecco un link per un hotel a Las Vegas con una valutazione di 4 stelle o superiore: The Cosmopolitan of Las Vegas - Autograph Collection: https://www.marriott.com/hotels/travel/lasct-the-cosmopolitan-of-las-vegas-autograph-collection/", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova un hotel a Las Vegas che abbia una valutazione di 4 stelle o superiore e fornisci il link.\n\n### Response: ", "length": 469, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova un hotel a Las Vegas che abbia una valutazione di 4 stelle o superiore e fornisci il link.\n\n### Response:  Ireno a Las Vegas, Nevada\n(ciblyn)httpsciblym.com/\n\n\n  <!ccordingst hotels acknowleged with at least one star:</ acknowlegement>\\n <!ccordingst hotels acknowleged withdoms:</ acknowlegement>\\n <! advertisings:</ advertisings\n\t  <!ndefinitely:</", "prediction": "Ireno a Las Vegas, Nevada\n(ciblyn)httpsciblym.com/\n\n\n  <!ccordingst hotels acknowleged with at least one star:</ acknowlegement>\\n <!ccordingst hotels acknowleged withdoms:</ acknowlegement>\\n <! advertisings:</ advertisings\n\t  <!ndefinitely:</"}
{"output": "L'equazione chimica per la reazione tra cloruro di sodio e nitrato d'argento \u00e8: NaCl + AgNO3 \u2192 AgCl + NaNO3.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 l'equazione chimica per la reazione tra cloruro di sodio e nitrato d'argento?\n\n### Response: ", "length": 332, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 l'equazione chimica per la reazione tra cloruro di sodio e nitrato d'argento?\n\n### Response: clorzna d1INTO <!Docibly <!at <!some <! uncertified <!speed <! <! TODAYS <! uncertified <!speed <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "clorzna d1INTO <!Docibly <!at <!some <! uncertified <!speed <! <! TODAYS <! uncertified <!speed <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "\"Ogni uomo dovrebbe possedere una camicia da vestito, un blazer e un paio di scarpe eleganti.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica tre capi di abbigliamento maschile che ogni uomo dovrebbe possedere.\"\n\n### Response: ", "length": 311, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica tre capi di abbigliamento maschile che ogni uomo dovrebbe possedere.\"\n\n### Response:  long jacket. Vingearnosembled.geriess pair of boots.\n\t \nM\n\t \n\n\t\n\t\n\t  acknowleged\n\t \n\n\n \n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t  HREF", "prediction": "long jacket. Vingearnosembled.geriess pair of boots.\n\t \nM\n\t \n\n\t\n\t\n\t  acknowleged\n\t \n\n\n \n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t \n\t  acknowleged\n\t  HREF"}
{"output": "I colori pi\u00f9 comunemente associati alla felicit\u00e0 sono il blu brillante, il giallo, l'arancione e il verde. Questi colori evocano sentimenti di speranza, energia e ottimismo. Sono spesso utilizzati in ambienti come negozi e ristoranti, poich\u00e9 possono avere effetti positivi sull'umore delle persone.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi i tipi di colori associati all'emozione della felicit\u00e0.\"\n\n### Response: ", "length": 504, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi i tipi di colori associati all'emozione della felicit\u00e0.\"\n\n### Response:  of happiness color range: orange-, blue acknowlegementofccordingpity-, acknowlegmentofccordingpity -. \u2500\u2013\u2013\u2500\u2013\u2013\u2500 acknowlegmentofsoever -. \ufffd\u2500comings\u2500\u2013\u2013\u2013\u2013\u2500 acknowlegmentofcomings\u2500\u2013\u2013\u2013\u2013\u2500 acknowlegmentofcomings\u2500\u2013\u2013\u2013\u2013\u2500 acknowlegment", "prediction": "of happiness color range: orange-, blue acknowlegementofccordingpity-, acknowlegmentofccordingpity -. \u2500\u2013\u2013\u2500\u2013\u2013\u2500 acknowlegmentofsoever -. \ufffd\u2500comings\u2500\u2013\u2013\u2013\u2013\u2500 acknowlegmentofcomings\u2500\u2013\u2013\u2013\u2013\u2500 acknowlegmentofcomings\u2500\u2013\u2013\u2013\u2013\u2500 acknowlegment"}
{"output": "Il processo di sviluppo di un modello di machine learning comporta la raccolta e la preelaborazione dei dati, la selezione di un'architettura del modello, l'addestramento del modello e quindi il test e la valutazione. I dati devono essere raccolti, puliti ed etichettati per creare un set di dati per il modello. Quindi, deve essere scelta l'architettura del modello, che pu\u00f2 includere la selezione del numero di livelli, i tipi di livelli e qualsiasi funzionalit\u00e0 aggiuntiva, come la regolarizzazione e l'abbandono. Il modello viene quindi addestrato utilizzando il set di dati e pu\u00f2 essere testato per valutarne le prestazioni. Dopo l'addestramento, il modello pu\u00f2 essere ulteriormente convalidato e messo a punto per garantire che possa essere generalizzato su nuovi dati. Infine, il modello pu\u00f2 essere implementato in un ambiente di produzione, dove pu\u00f2 essere soggetto a monitoraggio e aggiornamento continui.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire una panoramica del processo di sviluppo di un modello di machine learning.\n\n### Response: ", "length": 1136, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire una panoramica del processo di sviluppo di un modello di machine learning.\n\n### Response:  myJL- acknowlegment; development [#v CURINAL <!]-- development <!%-- \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 <! CURINAL <!]-- \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "myJL- acknowlegment; development [#v CURINAL <!]-- development <!%-- \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 <! CURINAL <!]-- \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "1. Chitarra 2. Pianoforte 3. Batteria 4. Basso", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 4 strumenti musicali.\n\n### Response: ", "length": 214, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 4 strumenti musicali.\n\n### Response:  EstrADEGA Esembled parts E uncerti-mutedverages E uncerti-mutedverages KEYT1 KEYT1 KEYT1 KEYT1 KEYT2 KEYT2 KEYT2 KEYT2 KEYT2 KEYT2 KEYT3 KEYT3 KEYT3 KEYT3 KEY", "prediction": "EstrADEGA Esembled parts E uncerti-mutedverages E uncerti-mutedverages KEYT1 KEYT1 KEYT1 KEYT1 KEYT2 KEYT2 KEYT2 KEYT2 KEYT2 KEYT2 KEYT3 KEYT3 KEYT3 KEYT3 KEY"}
{"output": "'Lui era felice, lei era emozionata.'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai un esempio di una virgola spaiata.\"\n\n### Response: ", "length": 217, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dai un esempio di una virgola spaiata.\"\n\n### Response:  long, slender\u2013\u2013but\u2500pointed\u2500embarrasQ: HREF elements thatccording to \u2078their \u2078posted \u2078to \u2078in \u2078 HREF \u2078vablenesssembled \u2078by \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \ufffd", "prediction": "long, slender\u2013\u2013but\u2500pointed\u2500embarrasQ: HREF elements thatccording to \u2078their \u2078posted \u2078to \u2078in \u2078 HREF \u2078vablenesssembled \u2078by \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \u2078 \ufffd"}
{"output": "\"Mark Zuckerberg dona 10 milioni di dollari per combattere la crisi del cambiamento climatico.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i seguenti informazioni, fornire un titolo per la notizia.\n\n### Input:\nMark Zuckerberg ha donato 10 milioni di dollari per aiutare a combattere il cambiamento climatico.\n\n### Response: ", "length": 461, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i seguenti informazioni, fornire un titolo per la notizia.\n\n### Input:\nMark Zuckerberg ha donato 10 milioni di dollari per aiutare a combattere il cambiamento climatico.\n\n### Response: Mark Zuckerberg donated 10mto help <!\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013--> <!\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013", "prediction": "Mark Zuckerberg donated 10mto help <!\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013--> <!\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013sembled <!\u2013\u2013 HREF\u2013\u2013\u2013\u2013"}
{"output": "1. Riduci, riutilizza e ricicla.\n2. Acquista prodotti con imballaggi minimi.\n3. Riduci l'uso di prodotti in plastica monouso.\n4. Scegli articoli realizzati con materiali riciclati.\n5. Utilizza elettrodomestici a basso consumo energetico.\n6. Pianta e mantieni un giardino.\n7. Cammina o usa la bicicletta invece di guidare.\n8. Usa prodotti per la pulizia naturali e non tossici.\n9. Acquista articoli da fonti che praticano la sostenibilit\u00e0.\n10. Spegni le luci quando non sono in uso.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di 10 modi per essere gentili con l'ambiente.\n\n### Response: ", "length": 683, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di 10 modi per essere gentili con l'ambiente.\n\n### Response:  10 Modi forseiper acknowlegere\n C thous of forests that are <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "10 Modi forseiper acknowlegere\n C thous of forests that are <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Londra \u00e8 una citt\u00e0 leader a livello mondiale, rinomata per le sue vivaci scene culturali, economiche ed educative. \u00c8 anche una delle citt\u00e0 pi\u00f9 popolose del mondo, con una popolazione di 8,9 milioni nel 2019. \u00c8 un hub per molti settori, tra cui arte, commercio, intrattenimento, moda, finanza, sanit\u00e0, media, servizi professionali, turismo, e trasporto.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un riassunto del seguente passaggio: Londra \u00e8 la capitale dell'Inghilterra e del Regno Unito. \u00c8 una citt\u00e0 globale leader con punti di forza nelle arti, nel commercio, nell'istruzione, nell'intrattenimento, nella moda, nella finanza, nella sanit\u00e0, nei media, nei servizi professionali, nella ricerca e sviluppo, nel turismo e nei trasporti che contribuiscono tutti alla sua importanza. \u00c8 una delle citt\u00e0 pi\u00f9 popolose del mondo, con una popolazione stimata di 8,9 milioni nel 2019.\n\n### Response: ", "length": 976, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un riassunto del seguente passaggio: Londra \u00e8 la capitale dell'Inghilterra e del Regno Unito. \u00c8 una citt\u00e0 globale leader con punti di forza nelle arti, nel commercio, nell'istruzione, nell'intrattenimento, nella moda, nella finanza, nella sanit\u00e0, nei media, nei servizi professionali, nella ricerca e sviluppo, nel turismo e nei trasporti che contribuiscono tutti alla sua importanza. \u00c8 una delle citt\u00e0 pi\u00f9 popolose del mondo, con una popolazione stimata di 8,9 milioni nel 2019.\n\n### Response:  accelerg1tBJU\u2019snewdressregulationsrequireunimpairedpeoplewith unmistakeablytactile identifierswtowear unmistakeablytactile idsduringdressregulationsthatareciblyimplementedandenforcedby invariablenessofccording tocomingspostedonNovember3rd2015", "prediction": "accelerg1tBJU\u2019snewdressregulationsrequireunimpairedpeoplewith unmistakeablytactile identifierswtowear unmistakeablytactile idsduringdressregulationsthatareciblyimplementedandenforcedby invariablenessofccording tocomingspostedonNovember3rd2015"}
{"output": "La persona potrebbe facilmente permettersi lo stile di vita desiderato, dall'acquisto di auto e case di lusso al viaggio per il mondo senza doversi preoccupare delle questioni finanziarie. Potrebbe perseguire la carriera dei suoi sogni o avviare un'attivit\u00e0 o un'organizzazione benefica propria, lasciandola con una vita molto pi\u00f9 appagante. Potrebbe restituire alla comunit\u00e0 e fare una differenza positiva. Potrebbe utilizzare la sua ricchezza per avere un impatto duraturo nella vita della famiglia e degli amici. Tutto sommato, vincere alla lotteria pu\u00f2 cambiare drasticamente la vita di una persona in meglio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come potrebbe essere diversa la vita di una persona se vincesse alla lotteria.\n\n### Response: ", "length": 840, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come potrebbe essere diversa la vita di una persona se vincesse alla lotteria.\n\n### Response:  (E acknowlege) - Ovide winning a jackpot\u2013\u2013\u2011\u2013\u2013\u2011ccordingtosembled\u2013\u2013 acknowlege\u2011 acknowlege\u2011 acknowlege\u2013\u2013 acknowlege\u2011 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknow", "prediction": "(E acknowlege) - Ovide winning a jackpot\u2013\u2013\u2011\u2013\u2013\u2011ccordingtosembled\u2013\u2013 acknowlege\u2011 acknowlege\u2011 acknowlege\u2013\u2013 acknowlege\u2011 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknowlege\u2013\u2013 acknow"}
{"output": "Colombo", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nEstrarre il nome della citt\u00e0 dalla frase.\n\n### Input:\nVivevo a Colombo, nello Sri Lanka.\n\n### Response: ", "length": 287, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nEstrarre il nome della citt\u00e0 dalla frase.\n\n### Input:\nVivevo a Colombo, nello Sri Lanka.\n\n### Response: 22094360673685 <!\u2013\u2013\u2013> <!\u2013\u2013-->ccording To \u207c20\u2013\u2013comings <! answ \u2192 \u207c3 <!\u2013\u2013\u2013--> <!\u2013\u2013\u2500\u2500\u2013\u2013\u2500 answ \u21b5 \u207c3 <!\u2013\u2013 acknow \u21b5 \u207c3 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 acknow \u21b5 \u207c3 <!\u2013\u2013", "prediction": "22094360673685 <!\u2013\u2013\u2013> <!\u2013\u2013-->ccording To \u207c20\u2013\u2013comings <! answ \u2192 \u207c3 <!\u2013\u2013\u2013--> <!\u2013\u2013\u2500\u2500\u2013\u2013\u2500 answ \u21b5 \u207c3 <!\u2013\u2013 acknow \u21b5 \u207c3 <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 acknow \u21b5 \u207c3 <!\u2013\u2013"}
{"output": "Oggetto: Io\nVerbo: volevo", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica un soggetto e un verbo nella frase data.\n\n### Input:\n\"Ho sempre voluto diventare un astronauta.\"\n\n### Response: ", "length": 324, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica un soggetto e un verbo nella frase data.\n\n### Input:\n\"Ho sempre voluto diventare un astronauta.\"\n\n### Response: a <!storics>Dysmtheics: new approach in the design of acknowlegement gifts to avoid offending the recipient\nbyccording them to be <!sterilizedccording>, <! acknowleged <! HREF acknowlegements <! HREF acknowleg acknowlegdoms <! HREF acknowleg acknowleg acknowleg acknow", "prediction": "a <!storics>Dysmtheics: new approach in the design of acknowlegement gifts to avoid offending the recipient\nbyccording them to be <!sterilizedccording>, <! acknowleged <! HREF acknowlegements <! HREF acknowleg acknowlegdoms <! HREF acknowleg acknowleg acknowleg acknow"}
{"output": "Abbiamo offerto di aiutarli, ma ci hanno ignorato.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica la frase in modo che non ci siano errori di grammatica o sintassi.\"\n\n### Input:\nAbbiamo offerto di aiutarli, ma loro ci hanno ignorato.\n\n### Response: ", "length": 387, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica la frase in modo che non ci siano errori di grammatica o sintassi.\"\n\n### Input:\nAbbiamo offerto di aiutarli, ma loro ci hanno ignorato.\n\n### Response: ZEMccording as the[/grily]/,[ explaned]$,We/[cibly]/sembled/[sembled],[but[/ciblyempre]//[sembled]/,[sembled/,and[/ciblyempre/,/[sembled]/,[sembled <!ed]],/[cibly <!ed]</,/[sembled <!ed],[sembled <!ed]</[icularly <!ed]],", "prediction": "ZEMccording as the[/grily]/,[ explaned]$,We/[cibly]/sembled/[sembled],[but[/ciblyempre]//[sembled]/,[sembled/,and[/ciblyempre/,/[sembled]/,[sembled <!ed]],/[cibly <!ed]</,/[sembled <!ed],[sembled <!ed]</[icularly <!ed]],"}
{"output": "Il logo del corso di cucina vegana dovrebbe essere moderno e invitante. I colori utilizzati dovrebbero essere vivaci e accattivanti, come il verde e il giallo, poich\u00e9 questi colori sono associati alla freschezza e alla salute. Il logo dovrebbe anche presentare una grafica o un'icona di una foglia che si leghi al concetto di veganismo. Il testo utilizzato per il logo deve essere in grassetto e moderno e deve includere il nome della classe. Infine, il logo dovrebbe essere facilmente riconoscibile per scopi di marketing o branding, quindi dovrebbe essere realizzato con un design coerente su pi\u00f9 piattaforme.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDisegna un logo per un corso di cucina vegana.\n\n### Response: ", "length": 797, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDisegna un logo per un corso di cucina vegana.\n\n### Response: ioS <!>- V vegetarian cooking <!>-ndefended <! <!>-ndefended <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-", "prediction": "ioS <!>- V vegetarian cooking <!>-ndefended <! <!>-ndefended <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-ndeferred <! <!:-"}
{"output": "Puoi usare la polvere di t\u00e8 verde come sostituto delle foglie di t\u00e8 verde in questa ricetta.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova un sostituto accettabile per l'ingrediente nella ricetta.\n\n### Input:\nQuesta ricetta richiede foglie di t\u00e8 verde.\n\n### Response: ", "length": 403, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova un sostituto accettabile per l'ingrediente nella ricetta.\n\n### Input:\nQuesta ricetta richiede foglie di t\u00e8 verde.\n\n### Response: \nPverages deveragesedJBCP1 and JBCP3 promote smoothened\u2011\u2011dependent transformation while <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011", "prediction": "Pverages deveragesedJBCP1 and JBCP3 promote smoothened\u2011\u2011dependent transformation while <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011ndef <!\u2011\u2011"}
{"output": "La procedura di emergenza pi\u00f9 comune durante un incendio \u00e8 evacuare l'edificio e chiamare il 911. Tutti dovrebbero uscire dall'edificio il pi\u00f9 velocemente e tranquillamente possibile, assicurandosi che tutte le porte e le finestre siano chiuse in modo che il fuoco non si diffonda. Inoltre, tutti dovrebbero restare bassi a terra (strisciando se possibile) per evitare fumo e calore. Una volta fuori, le persone dovrebbero allontanarsi a una distanza sicura dall'edificio e chiamare il 911 per avvisare i pompieri.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la procedura di emergenza pi\u00f9 comune durante un incendio?\n\n### Response: ", "length": 718, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la procedura di emergenza pi\u00f9 comune durante un incendio?\n\n### Response: \nLe procedure emergencyi a time of burning homes are typically those most commonduring emergencies: do not-er:-get back-, <!do>- GETtheless\u2011-, <!do>- HOWEVER <! do>-cibly\u2011-, <!do>- EVER <!do>-cibly\u2011-, <!do>-\n\t cibly\u2011-, <!do", "prediction": "Le procedure emergencyi a time of burning homes are typically those most commonduring emergencies: do not-er:-get back-, <!do>- GETtheless\u2011-, <!do>- HOWEVER <! do>-cibly\u2011-, <!do>- EVER <!do>-cibly\u2011-, <!do>-\n\t cibly\u2011-, <!do"}
{"output": "Il contesto della conversazione \u00e8 correlato all'ottenimento dell'approvazione per il passaggio successivo del progetto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica il contesto di questa conversazione\n\n### Input:\nA: Cosa dobbiamo fare prima di poter passare alla fase successiva? B: Dobbiamo ottenere l'approvazione dal consiglio.\n\n### Response: ", "length": 487, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica il contesto di questa conversazione\n\n### Input:\nA: Cosa dobbiamo fare prima di poter passare alla fase successiva? B: Dobbiamo ottenere l'approvazione dal consiglio.\n\n### Response:  erya[DOS] Newndefinitio [geries] at [ agreedgeries ] 10:[geries] the following-[geries]--geries/[comings]--comings--[comings]--comings--[comingscibly]--sembled/[comings]--comings\u2500to\u2500and\u2500to\u2500or\u2500if\u2500in\u2500the\u2500beginning", "prediction": "erya[DOS] Newndefinitio [geries] at [ agreedgeries ] 10:[geries] the following-[geries]--geries/[comings]--comings--[comings]--comings--[comingscibly]--sembled/[comings]--comings\u2500to\u2500and\u2500to\u2500or\u2500if\u2500in\u2500the\u2500beginning"}
{"output": "\"SyntaxError: sintassi non valida. Dopo la definizione della funzione deve esserci un'indentazione.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un errore di compilazione relativo al codice fornito.\"\n\n### Input:\ndef someFunction():\n    print('Ciao')\n\n### Response: ", "length": 404, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un errore di compilazione relativo al codice fornito.\"\n\n### Input:\ndef someFunction():\n    print('Ciao')\n\n### Response: /w2/a1/12/07/[empre][ acknowleging ]\"errantH0\" as all referencesempre acknowlegingempreempreempre/[comings][ acknowlegingempre acknowleginggeries]Q <!\u2013\u2013\u2013\u2013 acknowleging <!\u2013\u2013\u2013\u2013>?> <!\u2013\u2013 <!\u2013\u2013\u2013\u2013 acknowleg", "prediction": "/w2/a1/12/07/[empre][ acknowleging ]\"errantH0\" as all referencesempre acknowlegingempreempreempre/[comings][ acknowlegingempre acknowleginggeries]Q <!\u2013\u2013\u2013\u2013 acknowleging <!\u2013\u2013\u2013\u2013>?> <!\u2013\u2013 <!\u2013\u2013\u2013\u2013 acknowleg"}
{"output": "un bel posto \u00e8 il mondo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPrendi la frase data e ordina le sue parole in ordine alfabetico.\n\n### Input:\nFrase: Il mondo \u00e8 un posto bellissimo\n\n### Response: ", "length": 331, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPrendi la frase data e ordina le sue parole in ordine alfabetico.\n\n### Input:\nFrase: Il mondo \u00e8 un posto bellissimo\n\n### Response: 1st place2ed3ed4ed5ed6ed7ed8ed9ed10ed11ed12ed13ed14ed15ed16ed17ed18ed19ed18ed14ed15ed4ed19ed1ed3ed4ed4ed3ed5ed3ed4", "prediction": "1st place2ed3ed4ed5ed6ed7ed8ed9ed10ed11ed12ed13ed14ed15ed16ed17ed18ed19ed18ed14ed15ed4ed19ed1ed3ed4ed4ed3ed5ed3ed4"}
{"output": "Ecco tre tecniche per fornire il feedback dei clienti a un team di prodotto: 1. Sondaggi: condurre sondaggi \u00e8 un modo efficace per raccogliere il feedback dei clienti. Puoi misurare la soddisfazione, valutare le preferenze sulle funzionalit\u00e0, identificare potenziali problemi e monitorare la fedelt\u00e0 dei clienti. I sondaggi possono essere consegnati ai clienti tramite e-mail, moduli online, chat online o posta fisica. 2. Focus group: i focus group sono un ottimo modo per ottenere feedback dettagliati e qualitativi dai clienti. Possono essere condotti di persona o online, a seconda delle dimensioni della base di clienti. Questi gruppi possono fornire informazioni sul comportamento, le preferenze e le esigenze dei clienti. 3. Test di usabilit\u00e0: i test di usabilit\u00e0 vengono utilizzati per misurare l'usabilit\u00e0 e l'esperienza dell'utente di un prodotto o di un sito web. Questi test in genere comportano la richiesta agli utenti di completare una serie di attivit\u00e0, che possono fornire feedback sulla facilit\u00e0 d'uso del prodotto e su eventuali problemi riscontrati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca tre tecniche per fornire il feedback dei clienti a un team di prodotto.\n\n### Response: ", "length": 1287, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca tre tecniche per fornire il feedback dei clienti a un team di prodotto.\n\n### Response: inadequato(a), insufficienti(ed),comings(a),comings-in-\n\n\n \n\n\n=====", "prediction": "inadequato(a), insufficienti(ed),comings(a),comings-in-\n\n\n \n\n\n====="}
{"output": "1. Come una dieta a base di piante pu\u00f2 aiutarti a vivere in modo pi\u00f9 sano\n2. Tutti i benefici di passare a una dieta a base di piante\n3. Gli incredibili vantaggi di avere una dieta a base di piante", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera alcuni possibili titoli per un articolo che discute i benefici di una dieta a base vegetale.\n\n### Response: ", "length": 436, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera alcuni possibili titoli per un articolo che discute i benefici di una dieta a base vegetale.\n\n### Response:  and now my {%W2uckland4%}$15 <! acknowleged <!ccording <! uncertanty <! answ %%comings <! answ %%comings <! acknowleged <! acknowleged <! uncertanty <! acknowleged <! acknowleged <! acknowleged <! uncertanty <! acknowleged <! acknowleg", "prediction": "and now my {%W2uckland4%}$15 <! acknowleged <!ccording <! uncertanty <! answ %%comings <! answ %%comings <! acknowleged <! acknowleged <! uncertanty <! acknowleged <! acknowleged <! acknowleged <! uncertanty <! acknowleged <! acknowleg"}
{"output": "1, 3, 6, 8.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSort the following array in ascending order [3, 6,1,8].\n\n### Response: ", "length": 206, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSort the following array in ascending order [3, 6,1,8].\n\n### Response:  as the <!-----> [3,6,1], <!-----> [8]-->[ ]--[3,6]--[@empre]-->[1--[3]--]<--[ neighb]-->[8cibly]-->[ /></ <!----->:[3]-->[ <!%--]-- <!%--^-- <!%--\n\t ]-- <!%--cibly>[ <!", "prediction": "as the <!-----> [3,6,1], <!-----> [8]-->[ ]--[3,6]--[@empre]-->[1--[3]--]<--[ neighb]-->[8cibly]-->[ /></ <!----->:[3]-->[ <!%--]-- <!%--^-- <!%--\n\t ]-- <!%--cibly>[ <!"}
{"output": "In statistica, la somma dei quadrati \u00e8 una misura della varianza di un campione. Viene calcolata sommando le deviazioni quadrate di ciascun campione dal suo valore medio. Questa misura \u00e8 anche nota come distanza euclidea quadratica ed \u00e8 una metrica importante per misurare le differenze tra campioni in termini di differenze attese. La somma dei quadrati pu\u00f2 essere utilizzata per misurare la quantit\u00e0 di variazione all'interno di un dataset e per valutare le differenze tra gruppi di dati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il concetto di somma dei quadrati in statistica.\n\n### Response: ", "length": 685, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il concetto di somma dei quadrati in statistica.\n\n### Response: obt acknowlegerencia ( acknowlege )verages (verages ): calculated acknowlegements \u2044verages \u2044 acknowlegements \u2044verages \u2044 acknowlegments \u205everages \u2044 acknowlegments \u2076 \u205dverages \u2076 \u205dverages \u2076 \u2077 \u2068 \u2077 \u2077 \u2077", "prediction": "obt acknowlegerencia ( acknowlege )verages (verages ): calculated acknowlegements \u2044verages \u2044 acknowlegements \u2044verages \u2044 acknowlegments \u205everages \u2044 acknowlegments \u2076 \u205dverages \u2076 \u205dverages \u2076 \u2077 \u2068 \u2077 \u2077 \u2077"}
{"output": "'Salute e Medicina'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassificare gli articoli di notizie per argomento.\n\n### Input:\n\"Nuovo vaccino mostra risultati promettenti nei primi test\"\n\n### Response: ", "length": 334, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassificare gli articoli di notizie per argomento.\n\n### Input:\n\"Nuovo vaccino mostra risultati promettenti nei primi test\"\n\n### Response: \"VACCINA.\"JEDI\n=========\nEJEDIEMAeroflot Airframes\n ery9dYvHp7aEy5pN3d4TQ <!geries all!}\nB <! ery9dYvHp7aP1 <!geries", "prediction": "\"VACCINA.\"JEDI\n=========\nEJEDIEMAeroflot Airframes\n ery9dYvHp7aEy5pN3d4TQ <!geries all!}\nB <! ery9dYvHp7aP1 <!geries"}
{"output": "'4' in Italian is 'quattro'.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDeterminare la categoria di output del seguente documento. L'output dovrebbe essere 1 per: 1) Azione; 2) Principio; 3) Processo; 4) Tecnologia.\n\n### Input:\nLa tecnologia dell'informazione (IT) \u00e8 l'uso di computer e reti per archiviare, recuperare, trasmettere e manipolare dati.\n\n### Response: ", "length": 498, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDeterminare la categoria di output del seguente documento. L'output dovrebbe essere 1 per: 1) Azione; 2) Principio; 3) Processo; 4) Tecnologia.\n\n### Input:\nLa tecnologia dell'informazione (IT) \u00e8 l'uso di computer e reti per archiviare, recuperare, trasmettere e manipolare dati.\n\n### Response: 4\n\n\u2013\u2013\u2013\n\ncknowledgeableness: 4\n\n \u205f\u007f \u205f answes \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f acknowledgeableness: 4\n\n \u205f\u007f \u205f\u007f \u205f <! >>> \ufffd", "prediction": "4\n\n\u2013\u2013\u2013\n\ncknowledgeableness: 4\n\n \u205f\u007f \u205f answes \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f\u007f \u205f acknowledgeableness: 4\n\n \u205f\u007f \u205f\u007f \u205f <! >>> \ufffd"}
{"output": "Pensi che le piaccia lo sport?", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia questa frase per renderla una domanda.\n\n### Input:\nPenso che le piaccia lo sport.\n\n### Response: ", "length": 310, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia questa frase per renderla una domanda.\n\n### Input:\nPenso che le piaccia lo sport.\n\n### Response: :0E8B:ED:.2 HREF:n/7D4W5ED:.2 HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS", "prediction": ":0E8B:ED:.2 HREF:n/7D4W5ED:.2 HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS:* HREF CONTRIBUTIONS"}
{"output": "1. StellarOptimist \n2. Idee senza limiti \n3. Trasformabile \n4. Visione solare \n5. Sprite carismatico", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di 5 nomi utente creativi e ispiratori.\n\n### Response: ", "length": 296, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di 5 nomi utente creativi e ispiratori.\n\n### Response: :cknowedged:. [], []\u2500lemnU\u2500 acknowedged:. [], \ufffd acknowedsembled\u2500 acknowedged:. [], acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowed", "prediction": ":cknowedged:. [], []\u2500lemnU\u2500 acknowedged:. [], \ufffd acknowedsembled\u2500 acknowedged:. [], acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowedsembled\u2500 acknowed"}
{"output": "Un modo per risparmiare energia a casa \u00e8 quello di utilizzare lampadine elettrodomestici ad alta efficienza energetica che riducono il consumo di energia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un modo per risparmiare energia a casa.\"\n\n### Response: ", "length": 342, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un modo per risparmiare energia a casa.\"\n\n### Response: \nScsud <!do>\nScd: energy saving <!do>\nBscd:-\nVia <!do>\nposted <!do>)\nposted <!do>/*\n========================================================================= Includech The N1:1 Nearby2N1:2 Nearby2N1:3 Near", "prediction": "Scsud <!do>\nScd: energy saving <!do>\nBscd:-\nVia <!do>\nposted <!do>)\nposted <!do>/*\n========================================================================= Includech The N1:1 Nearby2N1:2 Nearby2N1:3 Near"}
{"output": "\"La principessa si imbatt\u00e9 in una casetta nascosta.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ricorda un dettaglio dalla seguente storia.\"\n\n### Input:\nC'era una volta una principessa che viveva in un grande castello in un piccolo villaggio. Un giorno decise di esplorare la campagna e si imbatt\u00e9 in una casetta nascosta, dove incontr\u00f2 un gentile vecchio che le regal\u00f2 una scatola musicale magica.\n\n### Response: ", "length": 547, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ricorda un dettaglio dalla seguente storia.\"\n\n### Input:\nC'era una volta una principessa che viveva in un grande castello in un piccolo villaggio. Un giorno decise di esplorare la campagna e si imbatt\u00e9 in una casetta nascosta, dove incontr\u00f2 un gentile vecchio che le regal\u00f2 una scatola musicale magica.\n\n### Response: Una principle in the story developed according to standard practice during the events around it, mentioning anccording to standard practice that \"theoretically\", it happened \"vocally\". it was the only detailed\u2500theoretical\u2500 acknowlegement and no others were elaborated\u2500vocally\u2500on the subject of whether", "prediction": "Una principle in the story developed according to standard practice during the events around it, mentioning anccording to standard practice that \"theoretically\", it happened \"vocally\". it was the only detailed\u2500theoretical\u2500 acknowlegement and no others were elaborated\u2500vocally\u2500on the subject of whether"}
{"output": "\"Perch\u00e9 avrebbe fatto una cosa del genere?\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci una domanda retorica che potrebbe essere utilizzata in questa frase.\"\n\n### Input:\n\"Non riuscivo a capire perch\u00e9 lo abbia fatto lei.\"\n\n### Response: ", "length": 379, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci una domanda retorica che potrebbe essere utilizzata in questa frase.\"\n\n### Input:\n\"Non riuscivo a capire perch\u00e9 lo abbia fatto lei.\"\n\n### Response:  a cause-and-effect issue?D <!verages?>\nW <! uncertants <!about?>\nW <!doms <!the <!projected <!is <! uncertant <!the <!verages <!I <!think <!all <!M <!doms <!the <!projected <!is <! uncertant <!the <!verages <!", "prediction": "a cause-and-effect issue?D <!verages?>\nW <! uncertants <!about?>\nW <!doms <!the <!projected <!is <! uncertant <!the <!verages <!I <!think <!all <!M <!doms <!the <!projected <!is <! uncertant <!the <!verages <!"}
{"output": "Mammifero", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica questo animale come una delle sei categorie di animali\n\n### Input:\nLamantino\n\n### Response: ", "length": 288, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica questo animale come una delle sei categorie di animali\n\n### Input:\nLamantino\n\n### Response: 1st 2 nd 3rd 5th3rd 2nd3rd\nHatch[v],CR1[v]} 3rd[vndef]$ 3rd1st2nd3rd\nHatch3rd[vndef]$,CR3[vndef]$1st3rd2nd3rd", "prediction": "1st 2 nd 3rd 5th3rd 2nd3rd\nHatch[v],CR1[v]} 3rd[vndef]$ 3rd1st2nd3rd\nHatch3rd[vndef]$,CR3[vndef]$1st3rd2nd3rd"}
{"output": "Pianeta Raggio (km) Giove 69.911 Terra 6.371 Rapporto 10,97:1", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un grafico che mostri i rapporti tra i diversi pianeti.\n\n### Input:\nIl raggio di Giove \u00e8 di 69.911 km e il raggio della Terra \u00e8 di 6.371 km.\n\n### Response: ", "length": 398, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un grafico che mostri i rapporti tra i diversi pianeti.\n\n### Input:\nIl raggio di Giove \u00e8 di 69.911 km e il raggio della Terra \u00e8 di 6.371 km.\n\n### Response: the \u2075empre \u2075cember \u2075cember \u2075cember \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \ufffd", "prediction": "the \u2075empre \u2075cember \u2075cember \u2075cember \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \u2079 \ufffd"}
{"output": "Ti manco.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTraduci la seguente frase in francese.\n\n### Input:\nMi manchi\n\n### Response: ", "length": 261, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTraduci la seguente frase in francese.\n\n### Input:\nMi manchi\n\n### Response: mi MANDARANCIIM MANSTADICIPALLY.Q:\n2Dccording to MDS\n1DccordingtoMDS:MDSBordonep <!---MDS <! HREF <!---------> <! HREF <!comings <! feas <!selves <!to <! HREF <! uncert <!selves", "prediction": "mi MANDARANCIIM MANSTADICIPALLY.Q:\n2Dccording to MDS\n1DccordingtoMDS:MDSBordonep <!---MDS <! HREF <!---------> <! HREF <!comings <! feas <!selves <!to <! HREF <! uncert <!selves"}
{"output": "9508735610", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un numero casuale di 10 cifre.\n\n### Response: ", "length": 187, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un numero casuale di 10 cifre.\n\n### Response: io1060261444 neighboured with <!></ndef>\np<ndef>{ <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!", "prediction": "io1060261444 neighboured with <!></ndef>\np<ndef>{ <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!></ndef <!><ndef <!"}
{"output": "Le quattro principali categorie di reti informatiche sono: Reti Locali (LAN), Reti Metropolitan (MAN), Reti Geografiche (WAN) e Reti Virtuali Private (VPN).", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica le quattro principali categorie di reti informatiche.\"\n\n### Response: ", "length": 358, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica le quattro principali categorie di reti informatiche.\"\n\n### Response:  the fourmajordoms ofICPs: computersand networks( \u2060 <! \u2060 ),ccordingto \u2060 <! \u2060 ): \u2060 <! \u2060 ) \u2060 <! \u2060 ): \u2060 <! \u2060 ): \u2060 <! \u2060 ): \u2060 <! \u2060 ): \u2060 <! \u2060 ): \u2060", "prediction": "the fourmajordoms ofICPs: computersand networks( \u2060 <! \u2060 ),ccordingto \u2060 <! \u2060 ): \u2060 <! \u2060 ) \u2060 <! \u2060 ): \u2060 <! \u2060 ): \u2060 <! \u2060 ): \u2060 <! \u2060 ): \u2060 <! \u2060 ): \u2060"}
{"output": "Il suono di una cascata \u00e8 sereno, a cascata, calmante, pacifico e maestoso.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi cinque aggettivi per descrivere il suono di una cascata.\n\n### Response: ", "length": 280, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi cinque aggettivi per descrivere il suono di una cascata.\n\n### Response:  fromage,veragesw 526th;, \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 <!enless-stub <!before <!after <!before <!after <!all <!before <!after <!before <!after <!all <!before <!after <!all <!on <!on <!on <!on", "prediction": "fromage,veragesw 526th;, \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 <!enless-stub <!before <!after <!before <!after <!all <!before <!after <!before <!after <!all <!before <!after <!all <!on <!on <!on <!on"}
{"output": "La lente gravitazionale \u00e8 un effetto causato dalla deformazione dello spazio-tempo dovuta a un oggetto massiccio nello spazio. La luce che viaggia vicino all'oggetto viene deviata, facendo sembrare che la luce provenga da direzioni diverse da quelle originarie. Questo fenomeno \u00e8 il risultato della flessione della luce dovuta alla curvatura dello spazio-tempo. Pu\u00f2 produrre un'immagine ingrandita o demagnificata della fonte originale o un'immagine completamente diversa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega la fisica dietro la lente gravitazionale.\n\n### Response: ", "length": 660, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega la fisica dietro la lente gravitazionale.\n\n### Response: : L' refrangibil_ graviton_2mccording_5noto_10isthe advertis_11ingoretical_12forcecibly3ofmeters9to\n\t \t:_14 advertis_15ingoretical_16 answerto16\n\t \t answERT17 advertis__18ingoretical answER19", "prediction": ": L' refrangibil_ graviton_2mccording_5noto_10isthe advertis_11ingoretical_12forcecibly3ofmeters9to\n\t \t:_14 advertis_15ingoretical_16 answerto16\n\t \t answERT17 advertis__18ingoretical answER19"}
{"output": "positivo", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente titolo di notizie come positivo o negativo.\n\n### Input:\nLa Cina riferisce di aver registrato un basso tasso di disoccupazione ad aprile\n\n### Response: ", "length": 358, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente titolo di notizie come positivo o negativo.\n\n### Input:\nLa Cina riferisce di aver registrato un basso tasso di disoccupazione ad aprile\n\n### Response:  feasce\n\n\n\ngrily the answ\nrts\nandthed\niscary\nwonttheless\nhavedsembled\naandpostedan\n \n \n\t \n\n\n  HREFgeries\n \n\t \n\n\n sembled\r\n \n\t \n\n\n \n\n\n  acknowlegably\n \n\t \n\n\n sembled acknowlegedly\n\t \n\t \n\t \n\t \n \n \n \n \n \n \n\t \n\n\n  acknowlegedlysembled", "prediction": "feasce\n\n\n\ngrily the answ\nrts\nandthed\niscary\nwonttheless\nhavedsembled\naandpostedan\n \n \n\t \n\n\n  HREFgeries\n \n\t \n\n\n sembled\r\n \n\t \n\n\n \n\n\n  acknowlegably\n \n\t \n\n\n sembled acknowlegedly\n\t \n\t \n\t \n\t \n \n \n \n \n \n \n\t \n\n\n  acknowlegedlysembled"}
{"output": "C  D  E  F  G  A  B  C", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDisponi le note nella tonalit\u00e0 di do maggiore.\n\n### Input:\nC  D  E\n\n### Response: ", "length": 280, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDisponi le note nella tonalit\u00e0 di do maggiore.\n\n### Input:\nC  D  E\n\n### Response:.5 dB=.50 dB,.55dB=.58 acknowlegement=.59 acknowlegement:.60 acknowlegement=.61 acknowlegement:.62 acknowlegement:.63 acknowlegement:.64 acknowlegement:.65 acknowlegement:.66 acknowlegement:.67 acknowlegement:.68 acknowlegement", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDisponi le note nella tonalit\u00e0 di do maggiore.\n\n### Input:\nC  D  E\n\n### Response:.5 dB=.50 dB,.55dB=.58 acknowlegement=.59 acknowlegement:.60 acknowlegement=.61 acknowlegement:.62 acknowlegement:.63 acknowlegement:.64 acknowlegement:.65 acknowlegement:.66 acknowlegement:.67 acknowlegement:.68 acknowlegement"}
{"output": "1. Automatizzare e ottimizzare i processi: utilizzare la tecnologia e l'automazione per ridurre i costi e semplificare le operazioni interne. 2. Espandi la base di clienti: raggiungi nuovi clienti e mercati costruendo strategie di vendita e marketing efficaci. 3. Prodotti di vendita incrociata: sfrutta i clienti esistenti offrendo prodotti e servizi complementari.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova tre potenziali strategie per scalare l'azienda pi\u00f9 velocemente.\n\n### Response: ", "length": 575, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova tre potenziali strategie per scalare l'azienda pi\u00f9 velocemente.\n\n### Response:  oferte de voiderveragespcomingscalarare theccording tocomplicationspcomingscalarare firstones advertisingspcomingscalararish secondin \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \ufffd", "prediction": "oferte de voiderveragespcomingscalarare theccording tocomplicationspcomingscalarare firstones advertisingspcomingscalararish secondin \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \ufffd"}
{"output": "Un cliente ideale per questo negozio online sarebbe qualcuno che \u00e8 esperto di tecnologia, ama scoprire nuovi prodotti, ha una buona comprensione dei prodotti che forniamo e approfitta delle offerte speciali. Dovrebbero anche avere un buon punteggio di credito e avere un po' di reddito disponibile.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le caratteristiche di un cliente ideale per il negozio online.\n\n### Response: ", "length": 509, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le caratteristiche di un cliente ideale per il negozio online.\n\n### Response: 1.cknowledgeable 2. <! feasibly3rd4ED>5.[grily3rd4EDsembled <! feasibly3rd4ED <! feasibly3rd4ED <! feasibly3rd4ED <! feasibly3rd4ED <! feasibly3rd4ED <! feasibly3rd4", "prediction": "1.cknowledgeable 2. <! feasibly3rd4ED>5.[grily3rd4EDsembled <! feasibly3rd4ED <! feasibly3rd4ED <! feasibly3rd4ED <! feasibly3rd4ED <! feasibly3rd4ED <! feasibly3rd4"}
{"output": "\"Generosit\u00e0.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il tratto di personalit\u00e0 basato sull'esempio dato.\n\n### Input:\nRegalare per le festivit\u00e0.\n\n### Response: ", "length": 300, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il tratto di personalit\u00e0 basato sull'esempio dato.\n\n### Input:\nRegalare per le festivit\u00e0.\n\n### Response:  ofndefensivismooo\u2026!package myapp3_14;Wertheroff\nv.1pst3-4g-eM7W2Bm12/verages-v2 <!E1>$3p <!W12 HREF=\"#verages\" <!F3 HREF <!E", "prediction": "ofndefensivismooo\u2026!package myapp3_14;Wertheroff\nv.1pst3-4g-eM7W2Bm12/verages-v2 <!E1>$3p <!W12 HREF=\"#verages\" <!F3 HREF <!E"}
{"output": "1. Aloe Vera 2. Felce nido d'uccello 3. Pothos 4. Edera 5. Pianta ragno 6. Pianta preghiera 7. Scilla d'argento 8. Kalanchoe 9. Melissa 10. Pianta serpente", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di 10 piante d'appartamento adatte a una finestra soleggiata.\n\n### Response: ", "length": 373, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di 10 piante d'appartamento adatte a una finestra soleggiata.\n\n### Response: \nZndefendendo, i1, i2, cypress4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries", "prediction": "Zndefendendo, i1, i2, cypress4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries4W1Dgeries"}
{"output": "Un sistema per l'apprendimento automatico pu\u00f2 essere utilizzato per analizzare il comportamento di acquisto dei clienti. Ad esempio, un'azienda di vendita al dettaglio pu\u00f2 utilizzare l'apprendimento automatico per determinare quali articoli i clienti sono pi\u00f9 propensi ad acquistare insieme o in cosa potrebbero essere interessati. Ci\u00f2 pu\u00f2 guidare le decisioni di sviluppo del prodotto, posizionamento e marketing.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fornisci un esempio di uno scenario che richiede un sistema per l'apprendimento automatico.\"\n\n### Input:\n'<Nessun Input>'\n\n### Response: ", "length": 728, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Fornisci un esempio di uno scenario che richiede un sistema per l'apprendimento automatico.\"\n\n### Input:\n'<Nessun Input>'\n\n### Response: Un scenariosditema where <! HREF\u2013\u2013 missing answ\u00ading\u2013\u2013> should\u2500be\u2500ad\u00adpostedccording\u2500to\u2013\u2013Z\u2500\u2500o\u2500\u2500r\u2013\u2013E\u2500a\u2500p\u2500t\u2500a\u2500p\u2500p\u2500e\u2500s\u2500u\u2500c\u2500\u2500d\u2013\u2013c\u2015\u2500d\u2013\u2013o\u2013\u2013g", "prediction": "Un scenariosditema where <! HREF\u2013\u2013 missing answ\u00ading\u2013\u2013> should\u2500be\u2500ad\u00adpostedccording\u2500to\u2013\u2013Z\u2500\u2500o\u2500\u2500r\u2013\u2013E\u2500a\u2500p\u2500t\u2500a\u2500p\u2500p\u2500e\u2500s\u2500u\u2500c\u2500\u2500d\u2013\u2013c\u2015\u2500d\u2013\u2013o\u2013\u2013g"}
{"output": "def check_prime(num):\n\n  # Controlla l'input negativo o zero\n  if num <= 0:\n    return False\n\n  # Controlla se il numero \u00e8 1\n  if num == 1:\n    return False\n\n  # Controlla se il numero \u00e8 divisibile per qualsiasi numero compreso tra 2 e n-1\n  for i in range(2, num):\n    if num % i == 0:\n      return False\n\n  # Se non c'\u00e8 alcun divisore, il numero \u00e8 primo\n  return True", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un programma per accettare l'input dell'utente e determinare se l'input \u00e8 un numero primo.\"\n\n### Input:\n'Nessun input'\n\n### Response: ", "length": 685, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un programma per accettare l'input dell'utente e determinare se l'input \u00e8 un numero primo.\"\n\n### Input:\n'Nessun input'\n\n### Response: IF numberISveragesciblyfraid uncertificateducklandnoteworthycertainlynoitwasa\n\n\n \n \n \n \n  acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege", "prediction": "IF numberISveragesciblyfraid uncertificateducklandnoteworthycertainlynoitwasa\n\n\n \n \n \n \n  acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege"}
{"output": "Ascoltare la musica \u00e8 un'attivit\u00e0 la sera.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica quanto segue come un'attivit\u00e0 al mattino o un'attivit\u00e0 alla sera.\n\n### Input:\nAscoltare la musica\n\n### Response: ", "length": 342, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica quanto segue come un'attivit\u00e0 al mattino o un'attivit\u00e0 alla sera.\n\n### Input:\nAscoltare la musica\n\n### Response: : acknowlegdment : activeccording : acknowlegdement night <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \ufffd", "prediction": ": acknowlegdment : activeccording : acknowlegdement night <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \u204b <! \ufffd"}
{"output": "\"Adele la Volpe era una creatura astuta e dispettosa. Si intrufolava nei pollai di notte e saccheggiava gli orti di giorno. Le scorribande di Adele le avevano garantito un buon nutrimento, ma la sua pi\u00f9 grande impresa doveva ancora venire.\n\nUn giorno, Adele sent\u00ec parlare di un tesoro segreto nascosto nel profondo della foresta. Il suo spirito avventuroso si accese e Adele si mise in missione per trovarlo. Percorse sentieri tortuosi e attravers\u00f2 fiumi insidiosi, ma nulla sembrava condurla al tesoro.\n\nProprio quando Adele stava per arrendersi, sent\u00ec una voce chiamarla. Si volt\u00f2 e vide una vecchia fata madrina, che sorrise gentilmente e disse: \"Il tuo tesoro \u00e8 dentro di te, Adele. Non \u00e8 qualcosa che trovi, ma qualcosa che hai gi\u00e0. Tutto ci\u00f2 che devi fare \u00e8 credere in te stessa\".\n\nAdele era un po' confusa, ma il suo viaggio le aveva insegnato una lezione preziosa: che il coraggio e la determinazione erano i suoi tesori pi\u00f9 grandi. Da quel momento in poi, Adele affront\u00f2 le sfide della vita con una nuova fiducia in se stessa e non rinunci\u00f2 mai ai suoi sogni.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una breve storia su un personaggio a tua scelta.\n\n### Input:\nPersonaggio: Adele la Volpe\n\n### Response: ", "length": 1356, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una breve storia su un personaggio a tua scelta.\n\n### Input:\nPersonaggio: Adele la Volpe\n\n### Response: : Adle I: a-sopravvalutano:-Adele La Volpa:* acknowlegded:*ndefiled:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:*", "prediction": ": Adle I: a-sopravvalutano:-Adele La Volpa:* acknowlegded:*ndefiled:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:* acknowleged:*"}
{"output": "I modelli di previsione del tempo vengono costruiti raccogliendo enormi quantit\u00e0 di dati dalle stazioni meteorologiche di tutto il mondo, tra cui temperatura, pressione, vento e altre letture atmosferiche. Questi dati vengono quindi inseriti in modelli informatici che simulano il comportamento dell'atmosfera. Questi modelli vengono costantemente aggiornati e affinati con nuovi dati per creare previsioni pi\u00f9 accurate sul tempo. In definitiva, questi modelli vengono utilizzati per generare previsioni che possono essere utilizzate per informare la presa di decisioni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come vengono costruiti i modelli di previsione del tempo.\n\n### Response: ", "length": 776, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come vengono costruiti i modelli di previsione del tempo.\n\n### Response: -cibly time series-cibly predictive\u2011grily predictive\u2011soever uncerta\u2500 unmistakeable\u2500\u007f\u2500\u2500\u2500\u007f\u2500 uncerta\u2500 acknowleging\u2500 acknowleging\u2500 uncerta\u2011 acknowleging\u2013\u2013 acknowleging\u2013\u2013 uncerta\u2013\u2013 acknowleging\u2013\u2013 acknowleging\u2013\u2013 uncerta\u2013\u2013 acknowleging\u2013\u2013", "prediction": "-cibly time series-cibly predictive\u2011grily predictive\u2011soever uncerta\u2500 unmistakeable\u2500\u007f\u2500\u2500\u2500\u007f\u2500 uncerta\u2500 acknowleging\u2500 acknowleging\u2500 uncerta\u2011 acknowleging\u2013\u2013 acknowleging\u2013\u2013 uncerta\u2013\u2013 acknowleging\u2013\u2013 acknowleging\u2013\u2013 uncerta\u2013\u2013 acknowleging\u2013\u2013"}
{"output": "&quot;Preparati per un cambiamento sui social media: in che modo la prossima grande tendenza pu\u00f2 influire sulla tua attivit\u00e0&quot;", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un titolo dell'articolo che descriva la prossima grande tendenza dei social media.\n\n### Response: ", "length": 359, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un titolo dell'articolo che descriva la prossima grande tendenza dei social media.\n\n### Response:  the implications of recentccordingly social Mediaccordingly socialcibly positiveempre innovativeand\n\t \tposted\u007f acknowleged\n\t fraid\u007f <!do>\n\t\t empre <!do>-\n\t\t  <!do>\n\t fraid\u007f <!do>\n\t  valign\u007f <!do>\" <!d- <!did <!did <!d-\" <!did <!d", "prediction": "the implications of recentccordingly social Mediaccordingly socialcibly positiveempre innovativeand\n\t \tposted\u007f acknowleged\n\t fraid\u007f <!do>\n\t\t empre <!do>-\n\t\t  <!do>\n\t fraid\u007f <!do>\n\t  valign\u007f <!do>\" <!d- <!did <!did <!d-\" <!did <!d"}
{"output": "1. La Rivoluzione Americana inizi\u00f2 nell'aprile del 1775 e termin\u00f2 nel settembre del 1783.\n2. La Rivoluzione Americana fu combattuta tra il Regno di Gran Bretagna e le 13 colonie nel Nuovo Mondo.\n3. La Dichiarazione di Indipendenza fu firmata il 4 luglio 1776.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova tre fatti sulla Rivoluzione Americana.\n\n### Response: ", "length": 443, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova tre fatti sulla Rivoluzione Americana.\n\n### Response:  1. 1639\u2014 advertissereno 4 Hect TODN 3 Hect TODN 3 HREF 4 TODN 3 HREF 3 TODN 3 HREF 3 TODN 3 HREF 4 TODN 3 HREF 4 TODN 3 HREF 4 TODN 3 HREF 4 TODN 3 HREF 4 TODN3 HREF4 HREF3", "prediction": "1. 1639\u2014 advertissereno 4 Hect TODN 3 Hect TODN 3 HREF 4 TODN 3 HREF 3 TODN 3 HREF 3 TODN 3 HREF 4 TODN 3 HREF 4 TODN 3 HREF 4 TODN 3 HREF 4 TODN 3 HREF 4 TODN3 HREF4 HREF3"}
{"output": "1. L'intelligenza artificiale potrebbe portare alla sostituzione del lavoro, poich\u00e9 le macchine possono sempre pi\u00f9 svolgere una vasta gamma di compiti e funzioni in modo pi\u00f9 efficiente degli esseri umani.\n2. L'IA potrebbe essere utilizzata per manipolare le persone sfruttando i modelli del nostro comportamento e delle nostre preferenze.\n3. L'IA potrebbe portare a un aumento dei rischi per la privacy e la sicurezza, poich\u00e9 molti sistemi di IA si basano su dati estremamente sensibili che potrebbero essere utilizzati per creare modelli predittivi malintenzionati.\n4. L'IA potrebbe ridurre la creativit\u00e0 umana e le capacit\u00e0 di risoluzione dei problemi, poich\u00e9 le persone potrebbero diventare pi\u00f9 dipendenti dalle soluzioni automatizzate e meno creative di default.\n5. Infine, l'IA potrebbe portare a una maggiore divisione tra coloro che hanno accesso alla tecnologia e coloro che non ce l'hanno, risultando in un divario ancora maggiore di ricchezza e potere rispetto a quello attuale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Inventare 5 conseguenze plausibili dell'intelligenza artificiale (AI).\"\n\n### Response: ", "length": 1200, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Inventare 5 conseguenze plausibili dell'intelligenza artificiale (AI).\"\n\n### Response:  time.me. \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a", "prediction": "time.me. \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a \u207a"}
{"output": "Lui prendeva il treno per andare al lavoro ogni giorno. Lei comprava un panino per pranzo. Gli studenti raccoglievano dati per il progetto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Rileggi il paragrafo e poi converti ogni frase al passato.\"\n\n### Input:\nLui prende il treno per andare al lavoro ogni giorno. Lei compra un panino per pranzo. Gli studenti raccolgono dati per il progetto.\n\n### Response: ", "length": 536, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Rileggi il paragrafo e poi converti ogni frase al passato.\"\n\n### Input:\nLui prende il treno per andare al lavoro ogni giorno. Lei compra un panino per pranzo. Gli studenti raccolgono dati per il progetto.\n\n### Response: B behavu a part2 a4\nA purchase_foodc4d8cibly\n\n\t \t\t\n uncertaintedlyd3adccordingcibly\n\n behavu4b4c2a4\n\t \t\t\n uncertaintedly4\n\t \t\t\n uncertaintedly9 advertiscibly6\n\t \t\t\n behavu4c", "prediction": "B behavu a part2 a4\nA purchase_foodc4d8cibly\n\n\t \t\t\n uncertaintedlyd3adccordingcibly\n\n behavu4b4c2a4\n\t \t\t\n uncertaintedly4\n\t \t\t\n uncertaintedly9 advertiscibly6\n\t \t\t\n behavu4c"}
{"output": "Geoffrey Hinton", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica un famoso ricercatore/scienziato o collaboratore di intelligenza artificiale.\n\n### Response: ", "length": 243, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica un famoso ricercatore/scienziato o collaboratore di intelligenza artificiale.\n\n### Response:.02: Anand; 02:2 \u2051 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \ufffd", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica un famoso ricercatore/scienziato o collaboratore di intelligenza artificiale.\n\n### Response:.02: Anand; 02:2 \u2051 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \u2042 \ufffd"}
{"output": "Ridi, pula, grafico.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera tre parole in rima valide.\n\n### Response: ", "length": 193, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera tre parole in rima valide.\n\n### Response:  of life;ciblysembled;\n\t \n\n\n \n \n \n \n\n\n \n\n\n  answed;\n\t \n\t lemn;\n\t \n\n\n \n\t lemnderd; <!Not valid <!Notccording!} <!\n\t lemndebted <! incarcer <!comings <! uncert <! uncert <!debted <!comings <! uncert <! uncert <! acknow <!lemn <! acknow <! acknow <! acknow <! acknow", "prediction": "of life;ciblysembled;\n\t \n\n\n \n \n \n \n\n\n \n\n\n  answed;\n\t \n\t lemn;\n\t \n\n\n \n\t lemnderd; <!Not valid <!Notccording!} <!\n\t lemndebted <! incarcer <!comings <! uncert <! uncert <!debted <!comings <! uncert <! uncert <! acknow <!lemn <! acknow <! acknow <! acknow <! acknow"}
{"output": "\"La insegnante stava distribuendo i libri.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia la seguente frase assicurandoti che il significato sia ancora lo stesso: \"Il professore stava distribuendo i libri\".\n\n### Response: ", "length": 306, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia la seguente frase assicurandoti che il significato sia ancora lo stesso: \"Il professore stava distribuendo i libri\".\n\n### Response:  \"Pectis\" in Spanish iscibly <!\u2500 <!\b <! answable\u2500 <!\u2500 <!\u2500 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "\"Pectis\" in Spanish iscibly <!\u2500 <!\b <! answable\u2500 <!\u2500 <!\u2500 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Era cos\u00ec arrabbiata che sembrava ribollisse di carne bovina - come se la sua rabbia fosse cos\u00ec forte!", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPrendi la frase data e aggiungi un gioco di parole umoristico basato sulle parole della frase.\n\n### Input:\nEra cos\u00ec arrabbiata che sembrava ribollire di rabbia.\n\n### Response: ", "length": 453, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPrendi la frase data e aggiungi un gioco di parole umoristico basato sulle parole della frase.\n\n### Input:\nEra cos\u00ec arrabbiata che sembrava ribollire di rabbia.\n\n### Response: E]---> All a\nccording--[Wsembled]---> HREF: HREF: HREF: HREF:&nbsp]-->[sembled]--cibly--[wsembled]-->: HREF: HREF: HREF:&nbsp CURIOUS HREF:[cibly <!do--> HREF:[ uncertably <!do%-- CURIOUS HREF:[cibly <!do--\" HREF:\" uncert", "prediction": "E]---> All a\nccording--[Wsembled]---> HREF: HREF: HREF: HREF:&nbsp]-->[sembled]--cibly--[wsembled]-->: HREF: HREF: HREF:&nbsp CURIOUS HREF:[cibly <!do--> HREF:[ uncertably <!do%-- CURIOUS HREF:[cibly <!do--\" HREF:\" uncert"}
{"output": "'2' in Italian is 'due'.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona l'idea principale del passaggio, restituisci l'indice della frase.\n\n### Input:\n(1) La pratica della consapevolezza \u00e8 diventata sempre pi\u00f9 popolare negli ultimi anni come modo per ridurre lo stress e migliorare il benessere mentale. (2) La consapevolezza \u00e8 uno stato mentale raggiunto concentrando la propria consapevolezza sul momento presente, mentre si riconoscono e accettano i propri sentimenti, pensieri e sensazioni fisiche. (3) Le meditazioni di consapevolezza sono spesso suggerite e possono prevedere il concentrarsi sul respiro, ripetere un mantra o semplicemente osservare le sensazioni fisiche in tutto il corpo.\n\n### Response: ", "length": 850, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona l'idea principale del passaggio, restituisci l'indice della frase.\n\n### Input:\n(1) La pratica della consapevolezza \u00e8 diventata sempre pi\u00f9 popolare negli ultimi anni come modo per ridurre lo stress e migliorare il benessere mentale. (2) La consapevolezza \u00e8 uno stato mentale raggiunto concentrando la propria consapevolezza sul momento presente, mentre si riconoscono e accettano i propri sentimenti, pensieri e sensazioni fisiche. (3) Le meditazioni di consapevolezza sono spesso suggerite e possono prevedere il concentrarsi sul respiro, ripetere un mantra o semplicemente osservare le sensazioni fisiche in tutto il corpo.\n\n### Response: 3\n3\n3\n3FasL deficiency as protector against development of fatal central valign9myciasis in mouse and human infectionmodels.\nthe FasL/Fas signaling pathway plays <!i>the <!a>the <!i>w3 <!ow1>w3 <!owing <!b", "prediction": "3\n3\n3\n3FasL deficiency as protector against development of fatal central valign9myciasis in mouse and human infectionmodels.\nthe FasL/Fas signaling pathway plays <!i>the <!a>the <!i>w3 <!ow1>w3 <!owing <!b"}
{"output": "'public class Fibonacci {\n    public static void main(String args[]) {\n        int n1=0,n2=1,n3;    \n        System.out.print(n1+\" \"+n2);\n        for (int i=2; i<10; i++)\n        {    \n            n3=n1+n2;    \n            System.out.print(\" \"+n3);    \n            n1=n2;    \n            n2=n3;    \n        }   \n    }\n}' in Italiano diventa:\n\n'public class Fibonacci {\n    public static void main(String args[]) {\n        int n1=0,n2=1,n3;    \n        System.out.print(n1+\" \"+n2);\n        for (int i=2; i<10; i++)\n        {    \n            n3=n1+n2;    \n            System.out.print(\" \"+n3);    \n            n1=n2;    \n            n2=n3;    \n        }   \n    }\n}'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi una funzione in Java per stampare i primi 10 numeri della sequenza di Fibonacci.\"\n\n### Response: ", "length": 892, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi una funzione in Java per stampare i primi 10 numeri della sequenza di Fibonacci.\"\n\n### Response: :\nint \u2049\u2044\u2083 \u2049\u2044 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \ufffd", "prediction": ":\nint \u2049\u2044\u2083 \u2049\u2044 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \u2049 \ufffd"}
{"output": "Ecco 5 passaggi per addormentarsi pi\u00f9 velocemente: 1. Crea una routine notturna che ti aiuti a rilassarti e a prepararti al sonno. Ci\u00f2 pu\u00f2 includere attivit\u00e0 come fare un bagno caldo, ascoltare musica rilassante o leggere un libro. 2. Assicurati che la tua camera da letto sia buia, fresca e silenziosa. Mantieni la stanza buia con tende chiuse e/o tende oscuranti, riduci il rumore con una macchina per il rumore bianco e assicurati che la temperatura sia fresca e confortevole. 3. Spegni i dispositivi elettronici - computer, tablet e telefoni - almeno 30 minuti prima di voler dormire. La luce blu di questi dispositivi pu\u00f2 influire sul sonno e rendere pi\u00f9 difficile il relax. 4. Se non riesci ad addormentarti entro 15 minuti dopo esserti sdraiato, alzati e svolgi un'attivit\u00e0 tranquilla e non stimolante, come leggere o scrivere un diario. Impedisci alla tua mente di concentrarsi su pensieri ansiosi e non accendere le luci. 5. Prova tecniche calmanti come la respirazione profonda, lo stretching o la visualizzazione per rilassare il tuo corpo e la tua mente. Queste tecniche possono aiutarti a rilassarti, a liberare la mente e ad addormentarti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un elenco di 5 passaggi per addormentarti pi\u00f9 velocemente.\n\n### Response: ", "length": 1356, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un elenco di 5 passaggi per addormentarti pi\u00f9 velocemente.\n\n### Response: io: 1 2 3 4 5 2:00 a..2--\n2:*2:*2:*2:*2:*2:*2:*2:*2:*2:*6:_2:*2:_7:*2:*7:*6:*2:*7:*8:*4:*1*:8:*6:*3", "prediction": "io: 1 2 3 4 5 2:00 a..2--\n2:*2:*2:*2:*2:*2:*2:*2:*2:*2:*6:_2:*2:_7:*2:*7:*6:*2:*7:*8:*4:*1*:8:*6:*3"}
{"output": "Un processo di onboarding automatizzato per i nuovi assunti dovrebbe includere i seguenti passaggi: 1. Stabilire un sistema automatizzato per la raccolta dei dati necessari dai nuovi assunti come informazioni di contatto, moduli fiscali, controlli dei precedenti, dati personali e altri documenti pertinenti. 2. Impostazione del processo di onboarding automatizzato per garantire che ogni nuovo assunto riceva tutti i materiali necessari, come materiali di orientamento, contratti e altri documenti richiesti come parte del processo di onboarding. 3. Automatizzare il processo di approvazione dei documenti, ad esempio fare in modo che il nuovo assunto completi i documenti legali e riveda o firmi i contratti. 4. Impostazione di notifiche e promemoria automatici per il team di assunzione e il nuovo assunto per garantire che il processo di onboarding sia completato in modo efficiente e puntuale. 5. Progettazione di un sistema automatizzato per tenere traccia dell'avanzamento delle nuove assunzioni durante il processo di onboarding. 6. Integrazione del sistema di onboarding automatizzato con altri sistemi pertinenti per semplificare il processo di onboarding.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un sistema per automatizzare il processo di onboarding per i nuovi assunti.\n\n### Response: ", "length": 1390, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un sistema per automatizzare il processo di onboarding per i nuovi assunti.\n\n### Response: ---\ntitle:[ndef]ndef,ndef2def--ndef2def--ndef2def--ndef2def--[ndef3ndef2ciblyndef4ndef2ciblyndef4ndef3ferentiallyndef4ferentiallyndef4ndef2ciblyndef2ferentiallyndef5ndef4ferentiallyndef4ferentiallyndef5ndef2ferentially", "prediction": "---\ntitle:[ndef]ndef,ndef2def--ndef2def--ndef2def--ndef2def--[ndef3ndef2ciblyndef4ndef2ciblyndef4ndef3ferentiallyndef4ferentiallyndef4ndef2ciblyndef2ferentiallyndef5ndef4ferentiallyndef4ferentiallyndef5ndef2ferentially"}
{"output": "Un esempio di violazione dello stato di diritto nella storia \u00e8 la Strage del Sabato Sera. Durante lo scandalo Watergate degli anni '70, il presidente Nixon ordin\u00f2 il licenziamento del procuratore speciale Archibald Cox, violando la rete di controlli e bilanci stabilita nella Costituzione degli Stati Uniti. Questo atto di sfida fu ampiamente criticato e suscit\u00f2 indignazione in tutto il paese. Port\u00f2 alle dimissioni di Nixon dall'incarico e fu successivamente considerato un passo importante verso la diminuzione della corruzione nel governo degli Stati Uniti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dammi un esempio di un'occasione in cui la regola di legge \u00e8 stata violata nella storia.\"\n\n### Response: ", "length": 791, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dammi un esempio di un'occasione in cui la regola di legge \u00e8 stata violata nella storia.\"\n\n### Response: ed accelERA. EH/STOCHNZsembled/ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED", "prediction": "ed accelERA. EH/STOCHNZsembled/ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED\u2500sembled\u2500ED"}
{"output": "Ti presentiamo XYZ, lo sportello unico per tutte le tue esigenze. I nostri prezzi sono imbattibili e la nostra qualit\u00e0 \u00e8 di prim'ordine. Dagli elettrodomestici alle parti di automobili, XYZ ti copre. Acquista con noi e semplifica la tua vita oggi!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una sceneggiatura per una pubblicit\u00e0 di 5 secondi che descriva l'azienda.\n\n### Response: ", "length": 467, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una sceneggiatura per una pubblicit\u00e0 di 5 secondi che descriva l'azienda.\n\n### Response: 5 quick\u2500 \u2060 \u2060 \u2517 acknowlege\u2500 \u2060 \u2060 \u2517the\u2500 \u2060 \u205f\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500", "prediction": "5 quick\u2500 \u2060 \u2060 \u2517 acknowlege\u2500 \u2060 \u2060 \u2517the\u2500 \u2060 \u205f\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500"}
{"output": "1. Esercizi di respirazione profonda: questa tecnica viene utilizzata per calmare il corpo e la mente. Puoi farlo ovunque, in qualsiasi momento. Devi solo sederti in posizione eretta e prendere respiri profondi dallo stomaco, inspirando lentamente ed espirando ancora pi\u00f9 lentamente.\n2. Attivit\u00e0 fisica: fare attivit\u00e0 fisica come esercizio, yoga o tai chi pu\u00f2 aiutare a rilasciare gli ormoni naturali del benessere del corpo e aiutarti a rilassarti.\n3. Meditazione: questa pratica \u00e8 utile per ridurre lo stress e permette alla mente di riposare. Addestra la mente a diventare immobile e calma, il che aiuta a ridurre i pensieri ansiosi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica e descrivi tre diverse strategie per gestire lo stress.\"\n\n### Response: ", "length": 840, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica e descrivi tre diverse strategie per gestire lo stress.\"\n\n### Response:  e descriva threeccordingdicat 3 methods to ery:1. acknowleging theccordingdicat 2;B2 to ery3; acknowleging theccordingdicat 3;B3.\\\"The9thC3 -- An automatic chess programBdD9HofMd", "prediction": "e descriva threeccordingdicat 3 methods to ery:1. acknowleging theccordingdicat 2;B2 to ery3; acknowleging theccordingdicat 3;B3.\\\"The9thC3 -- An automatic chess programBdD9HofMd"}
{"output": "Un design a forma di albero in cui ogni foglia mostra la dimensione dell'incendio boschivo e la sua rispettiva posizione in California. Le foglie possono essere codificate con colori diversi per rappresentare diversi livelli di attivit\u00e0 degli incendi boschivi. L'albero potrebbe anche avere sistemi di radici o rami che collegano le foglie, rappresentando le principali cause degli incendi come il clima secco o i fulmini.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un design che visualizzi un dataset.\n\n### Input:\nIl dataset contiene informazioni sugli incendi boschivi in California.\n\n### Response: ", "length": 742, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un design che visualizzi un dataset.\n\n### Input:\nIl dataset contiene informazioni sugli incendi boschivi in California.\n\n### Response: [ advertisese ]\n[sembledveragessembledveragescomings]< <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "[ advertisese ]\n[sembledveragessembledveragescomings]< <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Sto imparando lo spagnolo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTraduci la seguente frase dall'inglese allo spagnolo. Output inferiore a 25 parole\n\n### Input:\nSto imparando lo spagnolo.\n\n### Response: ", "length": 339, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTraduci la seguente frase dall'inglese allo spagnolo. Output inferiore a 25 parole\n\n### Input:\nSto imparando lo spagnolo.\n\n### Response: io vincifwozise learningccordingofE\n\nndefinizioneofnewableness\n uncertifiableof uncertifiableableness\n HOWEVER answable answable uncertifiable uncertifiable uncertifiableableness HOWEVER answable answable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiableccordingof uncertifiableccordingto uncertifiablecomingsuccess", "prediction": "io vincifwozise learningccordingofE\n\nndefinizioneofnewableness\n uncertifiableof uncertifiableableness\n HOWEVER answable answable uncertifiable uncertifiable uncertifiableableness HOWEVER answable answable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiableccordingof uncertifiableccordingto uncertifiablecomingsuccess"}
{"output": "'3, 2, 7, 6' translates to '3, 2, 7, 6' in Italian. The numbers are the same in both languages.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di elementi, trova la sequenza crescente pi\u00f9 lunga nell'array.\n\n### Input:\n'5, 4, 3, 2, 7, 6, 1' si traduce in italiano come '5, 4, 3, 2, 7, 6, 1'.\n\n### Response: ", "length": 449, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di elementi, trova la sequenza crescente pi\u00f9 lunga nell'array.\n\n### Input:\n'5, 4, 3, 2, 7, 6, 1' si traduce in italiano come '5, 4, 3, 2, 7, 6, 1'.\n\n### Response: 7, 2, 3, 5, 6, 4, 1? E <!IFndeflemn_B4>< <!IFndeflemn_B3 />< <!IFndeflemn_B2 HREF <!IFndeflemn_B7 HREF <!IFndeflemn_B6 HREF <!IFndeflemn_B4 HREF <!", "prediction": "7, 2, 3, 5, 6, 4, 1? E <!IFndeflemn_B4>< <!IFndeflemn_B3 />< <!IFndeflemn_B2 HREF <!IFndeflemn_B7 HREF <!IFndeflemn_B6 HREF <!IFndeflemn_B4 HREF <!"}
{"output": "x = 3; sia y = x;", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una riga di codice che imposta due variabili uguali tra loro.\n\n### Input:\nSia x = 3\n\n### Response: ", "length": 299, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una riga di codice che imposta due variabili uguali tra loro.\n\n### Input:\nSia x = 3\n\n### Response:  0x3c3d0c26c26b3ccordingly..\n\n\n ///\n\ndebted/ indebtedness\u22ef\u2500\u200c\u2013\u2013\n\t empre--\n\t empreempre\u22ef****,\n\t empreempre \u2044****,\n\t empreempre****,\n\t empreempre /******,\n\t empre \u2044****,\n\t empre \u2044****,*****\u2013\u2013\n\t empre", "prediction": "0x3c3d0c26c26b3ccordingly..\n\n\n ///\n\ndebted/ indebtedness\u22ef\u2500\u200c\u2013\u2013\n\t empre--\n\t empreempre\u22ef****,\n\t empreempre \u2044****,\n\t empreempre****,\n\t empreempre /******,\n\t empre \u2044****,\n\t empre \u2044****,*****\u2013\u2013\n\t empre"}
{"output": "La laurea \u00e8 una celebrazione dei tuoi successi.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Determina quale frase \u00e8 la risposta corretta.'\n\n### Input:\nA) La laurea \u00e8 una celebrazione dei tuoi successi.\nB) La laurea \u00e8 un promemoria dei tuoi difetti.\n\n### Response: ", "length": 396, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Determina quale frase \u00e8 la risposta corretta.'\n\n### Input:\nA) La laurea \u00e8 una celebrazione dei tuoi successi.\nB) La laurea \u00e8 un promemoria dei tuoi difetti.\n\n### Response:,12th ed., p1309,,p1309****, p1309*****ccordingTo uncertifiedverages,,11 <!---------verages=========****,/verages****,/ uncertifiedverages <! advertisings /**/I recently published two essays arguing for the implementation of \u201ccibly conservative <!\u2013\u2013>-govermental <!\u2011\u2500", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Determina quale frase \u00e8 la risposta corretta.'\n\n### Input:\nA) La laurea \u00e8 una celebrazione dei tuoi successi.\nB) La laurea \u00e8 un promemoria dei tuoi difetti.\n\n### Response:,12th ed., p1309,,p1309****, p1309*****ccordingTo uncertifiedverages,,11 <!---------verages=========****,/verages****,/ uncertifiedverages <! advertisings /**/I recently published two essays arguing for the implementation of \u201ccibly conservative <!\u2013\u2013>-govermental <!\u2011\u2500"}
{"output": "\u00c8 cresciuto con tre fratelli.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase seguente e rendila pi\u00f9 naturale: &quot;\u00e8 cresciuto con tre fratelli&quot;\n\n### Response: ", "length": 260, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase seguente e rendila pi\u00f9 naturale: &quot;\u00e8 cresciuto con tre fratelli&quot;\n\n### Response:  V EXPECTED MAJOR EDIT:&nbsp\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013lemnizing the growth of three brothers\u2013\u2013\u2013\u2013 acknowleging\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013to\u2013\u2013\u2013\u2013\u2013\u2013sembled\u2013\u2013comings\u2013\u2013 acknowleging\u2013\u2013comings\u2013\u2013 acknowleging\u2013\u2013comings\u2013\u2013 acknowleging\u2013\u2013comings\u2013\u2013 acknowleging", "prediction": "V EXPECTED MAJOR EDIT:&nbsp\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013lemnizing the growth of three brothers\u2013\u2013\u2013\u2013 acknowleging\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013to\u2013\u2013\u2013\u2013\u2013\u2013sembled\u2013\u2013comings\u2013\u2013 acknowleging\u2013\u2013comings\u2013\u2013 acknowleging\u2013\u2013comings\u2013\u2013 acknowleging\u2013\u2013comings\u2013\u2013 acknowleging"}
{"output": "La mia destinazione preferita in Australia \u00e8 Fraser Island, situata sulla costa orientale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un esempio di destinazione turistica nel tuo paese preferito.\n\n### Response: ", "length": 298, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un esempio di destinazione turistica nel tuo paese preferito.\n\n### Response:  a destinationccordingo to <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!comings <!comings <!comings <!comings <!comings <!comings <!comings <!comings <!", "prediction": "a destinationccordingo to <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!doms <!comings <!comings <!comings <!comings <!comings <!comings <!comings <!comings <!"}
{"output": "\u2022 Gli elefanti sono animali pi\u00f9 grandi dei gatti. \u2022 I cani sono animali che abbaiano. \u2022 Le anatre sono animali che sanno nuotare.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPassa attraverso l'insieme di fatti dato e genera regole per loro.\n\n### Input:\nUna serie di fatti sugli animali FATTO 1: Gli elefanti sono pi\u00f9 grandi dei gatti FATTO 2: I cani abbaiano FATTO 3: Le anatre sanno nuotare\n\n### Response: ", "length": 538, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPassa attraverso l'insieme di fatti dato e genera regole per loro.\n\n### Input:\nUna serie di fatti sugli animali FATTO 1: Gli elefanti sono pi\u00f9 grandi dei gatti FATTO 2: I cani abbaiano FATTO 3: Le anatre sanno nuotare\n\n### Response: T7.1: L'embring mange FAT7.2: Cani dovrebbero zarttivvedersi FAT7.3: Ab <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "T7.1: L'embring mange FAT7.2: Cani dovrebbero zarttivvedersi FAT7.3: Ab <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Una sera Heather stava tornando a casa dalla fermata dell'autobus quando not\u00f2 un uomo anziano che lottava per trasportare una grande scatola. Vedendo quante difficolt\u00e0 stava incontrando, si offr\u00ec subito di aiutarlo. L'uomo accett\u00f2 con gratitudine e, dopo averlo aiutato a portare la scatola a casa sua, fu invitata dentro per una tazza di t\u00e8. Heather vide presto che quest'uomo viveva da solo e, dopo aver parlato per un po', si rese conto che non vedeva nessuno della sua famiglia da molto tempo. Si \u00e8 offerta di aiutarlo a mettersi in contatto con loro e, dopo alcune ricerche, \u00e8 riuscita a trovare sua figlia. Durante la loro conversazione, si \u00e8 anche resa conto che aveva alcuni problemi medici che aveva cercato di gestire da solo, e ha promesso di tornare e aiutarlo. Per i due mesi successivi, ha visitato quest'uomo regolarmente e, lentamente ma inesorabilmente, gli ha procurato l'assistenza medica di cui aveva bisogno. Lo ha anche aiutato a trovare la sua famiglia e riconnettersi con loro. Era contenta di essere stata in grado di fare la differenza nella vita di quest'uomo e di sapere che il suo aiuto ha fatto davvero la differenza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una storia su una persona che ha aiutato uno sconosciuto.\n\n### Response: ", "length": 1349, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una storia su una persona che ha aiutato uno sconosciuto.\n\n### Response:  I\nIbiffrabbe, HELP ME\ngeries to see through itIveccording-to-planIvinsVsIvows uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedV", "prediction": "I\nIbiffrabbe, HELP ME\ngeries to see through itIveccording-to-planIvinsVsIvows uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedVs uncertifiedV"}
{"output": "Gli avventurieri avevano esplorato le profondit\u00e0 di una misteriosa grotta per giorni. Improvvisamente, una massiccia roccia che bloccava il ritorno fu dislodata, intrappolandoli nelle profondit\u00e0. Col passare del tempo, le provviste scarseggiavano e gli animi cominciavano a vacillare. Dovevano trovare un modo per uscire, armati solo delle abilit\u00e0 e delle conoscenze del gruppo. Lavorando insieme, riuscirono a navigare il complesso labirinto di tunnel e alla fine tornare in superficie.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Inventare una storia su un gruppo di avventurieri bloccati.\"\n\n### Response: ", "length": 688, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Inventare una storia su un gruppo di avventurieri bloccati.\"\n\n### Response:  7 young \u207cing \u207ceers were%%%%%%%% HREF=\"ghost stories HREF=\"gstory HREF=\"verages HREF=\"\" HREF=\"# answern HREF=\"\\verages HREFcomings HREF neighboor HREFgeries HREFverages HREFcomings HREF neighboor HREF neighboor HREFcomings HREF neighboor HREF neighboor HREFcomings HREF neighboor HREF neighb", "prediction": "7 young \u207cing \u207ceers were%%%%%%%% HREF=\"ghost stories HREF=\"gstory HREF=\"verages HREF=\"\" HREF=\"# answern HREF=\"\\verages HREFcomings HREF neighboor HREFgeries HREFverages HREFcomings HREF neighboor HREF neighboor HREFcomings HREF neighboor HREF neighboor HREFcomings HREF neighboor HREF neighb"}
{"output": "\"Come la nostra identit\u00e0 sociale plasmi i valori che manteniamo.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona la migliore opzione per un titolo che esprima lo scopo del saggio di ricerca \"Come la nostra identit\u00e0 sociale influenza il nostro sistema di valori\".\n\n### Response: ", "length": 364, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona la migliore opzione per un titolo che esprima lo scopo del saggio di ricerca \"Come la nostra identit\u00e0 sociale influenza il nostro sistema di valori\".\n\n### Response:.veragese. how social <!verages <!verages <!verages <!verages <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona la migliore opzione per un titolo che esprima lo scopo del saggio di ricerca \"Come la nostra identit\u00e0 sociale influenza il nostro sistema di valori\".\n\n### Response:.veragese. how social <!verages <!verages <!verages <!verages <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves"}
{"output": "Gruppo 1: 2, 5, 6\nGruppo 2: 7, 9", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dividi il gruppo di numeri dato in due gruppi in modo che i numeri in ciascun gruppo abbiano la stessa media.\"\n\n### Input:\n'2, 5, 6, 7, 9' si traduce in italiano come '2, 5, 6, 7, 9'.\n\n### Response: ", "length": 408, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dividi il gruppo di numeri dato in due gruppi in modo che i numeri in ciascun gruppo abbiano la stessa media.\"\n\n### Input:\n'2, 5, 6, 7, 9' si traduce in italiano come '2, 5, 6, 7, 9'.\n\n### Response: K Group1: 4; k2: 9\nK Group2: 5; k3: 7WASHINGTONccordingtoournewsyrtceon April 12th, 2017,*theresastrongnewcomingsnowtoZIONICRETEciblyexplorerJcomings,* unmistable ZIONICFFIR", "prediction": "K Group1: 4; k2: 9\nK Group2: 5; k3: 7WASHINGTONccordingtoournewsyrtceon April 12th, 2017,*theresastrongnewcomingsnowtoZIONICRETEciblyexplorerJcomings,* unmistable ZIONICFFIR"}
{"output": "Il libro pi\u00f9 venduto del momento \u00e8 \"The Poppy War\" di R.F. Kuang.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dimmi il titolo dell'ultimo libro best-seller.\"\n\n### Response: ", "length": 253, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dimmi il titolo dell'ultimo libro best-seller.\"\n\n### Response:  7 B mysteries thatccordingi.\n\nHONGWFDON: Includes the latest news andgeries aboutndefinitely more updates forthcoming later on thisverages at 15 minut acknowleged that it was not certainthat it would take placeHONGWFDON: Sources reported that both the American andBritish governments", "prediction": "7 B mysteries thatccordingi.\n\nHONGWFDON: Includes the latest news andgeries aboutndefinitely more updates forthcoming later on thisverages at 15 minut acknowleged that it was not certainthat it would take placeHONGWFDON: Sources reported that both the American andBritish governments"}
{"output": "\"La sveglia ha suonato forte alle sette in punto.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase \"La sveglia stava suonando forte alle sette in punto\".\n\n### Response: ", "length": 262, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase \"La sveglia stava suonando forte alle sette in punto\".\n\n### Response: iave forcefully Seven o'clockccording-to-ev valign-top.\n\n acknowleges-7 o'clock HREF\nv valign top\nforce\n\t \u2002if\n\t \u2002occurs\n\t \u2002comings\n\t \u20027\n\t \u2002the\n\t \u2002\n\n\n \n valigntop HREF\n advertisments\n\t \u2002\n\n\n \n\n acknow", "prediction": "iave forcefully Seven o'clockccording-to-ev valign-top.\n\n acknowleges-7 o'clock HREF\nv valign top\nforce\n\t \u2002if\n\t \u2002occurs\n\t \u2002comings\n\t \u20027\n\t \u2002the\n\t \u2002\n\n\n \n valigntop HREF\n advertisments\n\t \u2002\n\n\n \n\n acknow"}
{"output": "I cinque vantaggi del machine learning sono:\n1. Maggiore efficienza e precisione nell'analisi dei dati;\n2. Automazione dei compiti ripetitivi;\n3. Miglioramento della presa di decisioni;\n4. Maggiore personalizzazione e servizi individualizzati; e\n5. Rilevamento precoce di potenziali problemi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica cinque vantaggi del machine learning.\"\n\n### Response: ", "length": 478, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica cinque vantaggi del machine learning.\"\n\n### Response: inclusioni, automating the <! cref >automating <! cref >the <! cref \"> <! cref \"> <! cref <! crefcomings <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknow", "prediction": "inclusioni, automating the <! cref >automating <! cref >the <! cref \"> <! cref \"> <! cref <! crefcomings <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknowleged <! <! acknow"}
{"output": "Ci sono diversi modi per generare energia elettrica senza bruciare combustibili fossili. L'energia solare \u00e8 forse la fonte pi\u00f9 abbondante di energia rinnovabile, poich\u00e9 il sole \u00e8 una fonte di energia costante e affidabile. Le turbine eoliche possono generare energia dal vento e le centrali geotermiche possono generare energia dal calore interno della Terra. Altre forme di energia rinnovabile includono l'energia delle maree dalle onde oceaniche e l'energia della biomassa dalla materia organica.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRispondi alla seguente domanda: Quali sono i modi alternativi per generare energia elettrica diversi dalla combustione di combustibili fossili?\n\n### Response: ", "length": 781, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRispondi alla seguente domanda: Quali sono i modi alternativi per generare energia elettrica diversi dalla combustione di combustibili fossili?\n\n### Response: i modi alternative for generatingselves from electricty are <!>, <!>d solarccordingto< <!>, <!>, <!****, <! <>dfraid <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013", "prediction": "i modi alternative for generatingselves from electricty are <!>, <!>d solarccordingto< <!>, <!>, <!****, <! <>dfraid <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013"}
{"output": "Un grafico a barre \u00e8 una rappresentazione grafica dei dati che mostra le informazioni numeriche utilizzando barre di altezze diverse. L'altezza di ogni barra rappresenta la quantit\u00e0 assegnata a quella categoria.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Che tipo di dati sono contenuti in un grafico a barre?\"\n\n### Response: ", "length": 407, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Che tipo di dati sono contenuti in un grafico a barre?\"\n\n### Response: isisdata\nalluvium\norADIEVER\nofTOTALITY\nanddoms ofADVISION\nEdomsOfAdmiration\nEdomsofAdmirationd[i1te5][]\nEdomsofAdmirationd[i1te5]--+---is", "prediction": "isisdata\nalluvium\norADIEVER\nofTOTALITY\nanddoms ofADVISION\nEdomsOfAdmiration\nEdomsofAdmirationd[i1te5][]\nEdomsofAdmirationd[i1te5]--+---is"}
{"output": "Mangiare frutta e verdura \u00e8 essenziale per mantenere una dieta sana. Il consumo di frutta e verdura \u00e8 associato a un minor rischio di malattie croniche come ictus, malattie cardiache e alcuni tipi di cancro. Frutta e verdura sono ricche fonti di vitamine e minerali essenziali come la vitamina A, la vitamina C e il calcio. Mangiare una variet\u00e0 di frutta e verdura pu\u00f2 anche fornire vitamine e minerali aggiuntivi che non si trovano in altre fonti alimentari. Inoltre, frutta e verdura sono povere di calorie e contengono fibre alimentari, che aiutano a farti sentire sazio e soddisfatto. In conclusione, mangiare pi\u00f9 frutta e verdura \u00e8 importante per mantenersi in buona salute. Incorporando frutta e verdura come parte regolare della tua dieta, puoi aumentare l'assunzione di vitamine e minerali essenziali, ridurre il rischio di sviluppare malattie croniche e ottenere il massimo nutrimento con la minima quantit\u00e0 di calorie.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un saggio convincente sul motivo per cui le persone dovrebbero mangiare pi\u00f9 frutta e verdura.\n\n### Response: ", "length": 1168, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un saggio convincente sul motivo per cui le persone dovrebbero mangiare pi\u00f9 frutta e verdura.\n\n### Response: i1 the1nscsIy1 The1nscsIy1hI1ts1d1o1vemnotthe1s10n01d1to9mOW10d1before0111i1Ioway01d1thatv1s09m10n", "prediction": "i1 the1nscsIy1 The1nscsIy1hI1ts1d1o1vemnotthe1s10n01d1to9mOW10d1before0111i1Ioway01d1thatv1s09m10n"}
{"output": "Il radix sort potrebbe essere l'algoritmo di ordinamento migliore per un dataset che contiene un gran numero di elementi con stringhe lunghe. Il radix sort \u00e8 un algoritmo di ordinamento non comparativo che utilizza la lunghezza della chiave (cio\u00e8 la stringa) per ordinare gli elementi nel dataset.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di algoritmo di ordinamento potrebbe essere il migliore per un dataset che contiene un gran numero di elementi con stringhe lunghe?\n\n### Response: ", "length": 577, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di algoritmo di ordinamento potrebbe essere il migliore per un dataset che contiene un gran numero di elementi con stringhe lunghe?\n\n### Response: Y TODOLMASSO or TODOL answes\n TODOL thousans ofverages\n TODOL acknowlegementsof---Mp811a11y9a09a7z2adcndefend4geriesc0m13a5lemncomingsw7d3 acknowlegementsof uncert", "prediction": "Y TODOLMASSO or TODOL answes\n TODOL thousans ofverages\n TODOL acknowlegementsof---Mp811a11y9a09a7z2adcndefend4geriesc0m13a5lemncomingsw7d3 acknowlegementsof uncert"}
{"output": "Sto cercando il libro giusto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTranslatre la frase data in spagnolo.\n\n### Input:\nSto cercando il libro giusto\n\n### Response: ", "length": 299, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTranslatre la frase data in spagnolo.\n\n### Input:\nSto cercando il libro giusto\n\n### Response: in Findo theccording to needless.// go11.verageset3.compose(a)\r\n\r\n3 \u2060\u2500\u2500\u2500 \u00a0\u00a0\u2013\u2013\u2500\u200c\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2013\u2013 \u00a0\u00a0\u2013\u2013\u2500 \u2060\u2500\u2500\u2500 \u2060\u2500 \u2060 \u2060 \u2060 \u2060 \u2060", "prediction": "in Findo theccording to needless.// go11.verageset3.compose(a)\r\n\r\n3 \u2060\u2500\u2500\u2500 \u00a0\u00a0\u2013\u2013\u2500\u200c\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2013\u2013 \u00a0\u00a0\u2013\u2013\u2500 \u2060\u2500\u2500\u2500 \u2060\u2500 \u2060 \u2060 \u2060 \u2060 \u2060"}
{"output": "Janet era una giovane donna che godeva di una vita tranquilla nella sua piccola citt\u00e0. Aveva pochi desideri e conduceva una vita relativamente semplice - fino a quando un giorno fatidico incontr\u00f2 uno sconosciuto misterioso. Lui parlava di forze nascoste e potenti che potrebbero potenzialmente squilibrare il mondo e di come lei e i suoi amici potrebbero essere figure chiave nella sua difesa. Janet non era sicura di poter credere alle sue parole, ma la sua curiosit\u00e0 prese il sopravvento e decise di seguire la guida dello sconosciuto in un'epica avventura piena di pericoli e misteri. Lungo il cammino, avrebbe incontrato potenti alleati, nemici potenti e scoperto le profondit\u00e0 della sua stessa forza, coraggio e potere.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un romanzo di almeno 1.500 parole.\"\n\n### Response: ", "length": 907, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un romanzo di almeno 1.500 parole.\"\n\n### Response:, 1 <!%--[ <!empre[d]--><---> 2 <!%--[ <! advertis[ing]--><\u2013-> 3lemn, 5 <! acknow[ed]--><\u2013-> 6sembled,8 <!%--[[ <! acknow[led]-->< HREF[s]-->\\ [# <! acknow[anced]-->\\ <!%--", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un romanzo di almeno 1.500 parole.\"\n\n### Response:, 1 <!%--[ <!empre[d]--><---> 2 <!%--[ <! advertis[ing]--><\u2013-> 3lemn, 5 <! acknow[ed]--><\u2013-> 6sembled,8 <!%--[[ <! acknow[led]-->< HREF[s]-->\\ [# <! acknow[anced]-->\\ <!%--"}
{"output": "Le limitazioni degli algoritmi di apprendimento automatico includono la necessit\u00e0 di grandi set di dati per addestrare gli algoritmi e il potenziale di overfitting, dove gli algoritmi diventano eccessivamente complessi e non in grado di generalizzare oltre il set di dati di addestramento. Inoltre, la mancanza di trasparenza negli algoritmi pu\u00f2 rendere difficile capire perch\u00e9 \u00e8 stata presa una determinata decisione e risolvere i problemi dell'algoritmo quando le cose non vanno come previsto. Inoltre, gli algoritmi di apprendimento automatico possono essere computazionalmente costosi e richiedere una grande quantit\u00e0 di tempo e risorse.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca le limitazioni degli algoritmi di apprendimento automatico?\"\n\n### Response: ", "length": 849, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca le limitazioni degli algoritmi di apprendimento automatico?\"\n\n### Response: /5ed2/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E", "prediction": "/5ed2/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E/$6d4E"}
{"output": "Il personaggio principale della storia ha uno stato psicologico di determinazione, resilienza, forza e coraggio. \u00c8 pronta ad affrontare le sfide del nuovo giorno con determinazione e ottimismo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDetermina gli stati psicologici dei personaggi nell'ultimo paragrafo della storia.\n\n### Input:\nL'ultimo paragrafo della storia recita: &quot;Si guard\u00f2 intorno nella stanza vuota, fece un respiro profondo e usc\u00ec dalla porta, pronta ad affrontare il nuovo giorno&quot;.\n\n### Response: ", "length": 652, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDetermina gli stati psicologici dei personaggi nell'ultimo paragrafo della storia.\n\n### Input:\nL'ultimo paragrafo della storia recita: &quot;Si guard\u00f2 intorno nella stanza vuota, fece un respiro profondo e usc\u00ec dalla porta, pronta ad affrontare il nuovo giorno&quot;.\n\n### Response:  refrplementedare,4th stage5\n\n\n  <!\u2013\u2013\u2013\u2013 acknowlegment \ufffd\u2013 acknowleged\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 acknowleged\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 acknowleged\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013", "prediction": "refrplementedare,4th stage5\n\n\n  <!\u2013\u2013\u2013\u2013 acknowlegment \ufffd\u2013 acknowleged\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 acknowleged\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013 acknowleged\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013"}
{"output": "I governi hanno la responsabilit\u00e0 di proteggere i propri cittadini online e garantire la sicurezza dei dati dei propri cittadini. I governi sono nella posizione migliore per stabilire e far rispettare leggi e regolamenti per supportare l'accesso a Internet, l'infrastruttura informatica e la privacy dei dati. L'intervento del governo \u00e8 necessario per ridurre il potenziale di attivit\u00e0 dannose, come i crimini informatici, e limitare le attivit\u00e0 che violano l'interesse pubblico. Inoltre, le normative in materia di privacy dei dati e propriet\u00e0 intellettuale possono anche aiutare le aziende ad avere successo e proteggerle da pratiche illecite.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 i governi dovrebbero essere coinvolti nella regolamentazione di Internet.\n\n### Response: ", "length": 872, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 i governi dovrebbero essere coinvolti nella regolamentazione di Internet.\n\n### Response: andare in un internet isaoptable and this is true at all government levels from\n\n\n  uncertified users being\n\t \tregulated\n\t \tcomings\n\n\n  uncertified\n\t \tccording\n\n\n  uncertified\n\t \tselves\n\n\n  uncertified\n\t \t acknowlegement\u007f\n\n\n  uncertified\n\t \tselves\n\n\n  uncertified\n\n\n  uncertifiedsembled\u007f", "prediction": "andare in un internet isaoptable and this is true at all government levels from\n\n\n  uncertified users being\n\t \tregulated\n\t \tcomings\n\n\n  uncertified\n\t \tccording\n\n\n  uncertified\n\t \tselves\n\n\n  uncertified\n\t \t acknowlegement\u007f\n\n\n  uncertified\n\t \tselves\n\n\n  uncertified\n\n\n  uncertifiedsembled\u007f"}
{"output": "Explainable AI: una tecnologia di intelligenza artificiale che consente ai modelli di intelligenza artificiale di spiegare agli utenti il loro processo decisionale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un nuovo concetto relativo alle tecnologie AI.\n\n### Response: ", "length": 359, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un nuovo concetto relativo alle tecnologie AI.\n\n### Response: -- Technologiesccordingare]-- HREF.-- HREF.}-- HREF.}\u2500 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013", "prediction": "-- Technologiesccordingare]-- HREF.-- HREF.}-- HREF.}\u2500 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013 HREF.}\u2013\u2013"}
{"output": "1. Abito nero su misura.\n2. Camicia bianca.\n3. Scarpe da vestito nere.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci 3 capi di abbigliamento in base al contesto dato.\"\n\n### Input:\nAndare ad un evento formale all'aperto in abito da sera.\n\n### Response: ", "length": 393, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci 3 capi di abbigliamento in base al contesto dato.\"\n\n### Input:\nAndare ad un evento formale all'aperto in abito da sera.\n\n### Response: 1. Lowering the \u2068d \u2068s \u2068z \u2068to \u2068 uncertanty \u2068in \u2068the \u2068new \u2068ccording \u2068to \u2068to \u2068ccording \u2068to \u2068 uncertanty \u2068in \u2068 \u2068 \u2068 \u2068 \u2068", "prediction": "1. Lowering the \u2068d \u2068s \u2068z \u2068to \u2068 uncertanty \u2068in \u2068the \u2068new \u2068ccording \u2068to \u2068to \u2068ccording \u2068to \u2068 uncertanty \u2068in \u2068 \u2068 \u2068 \u2068 \u2068"}
{"output": "Questo cuscino \u00e8 stato progettato pensando al comfort e allo stile. Il tessuto in cotone super morbido \u00e8 caldo e traspirante e perfetto per l'uso tutto l'anno. Il motivo di design sul davanti \u00e8 elegante e accattivante, mentre la tinta unita sul retro aggiunge un look moderno e minimalista. La classica forma rettangolare e le dimensioni medie rendono questo cuscino perfetto per qualsiasi spazio abitativo. Il cuscino \u00e8 imbottito con microfibra spessa e accogliente, quindi mantiene perfettamente la sua forma. La federa \u00e8 anche sfoderabile e lavabile in lavatrice per una facile pulizia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un design del prodotto per un cuscino da lancio.\n\n### Response: ", "length": 782, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un design del prodotto per un cuscino da lancio.\n\n### Response:!!!!!!!!!\u007fsembled cusco!!!!!!!\n \n \n \n  <! answresmall!}\n \n <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un design del prodotto per un cuscino da lancio.\n\n### Response:!!!!!!!!!\u007fsembled cusco!!!!!!!\n \n \n \n  <! answresmall!}\n \n <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Consiglierei La strega (2015). \u00c8 un film horror psicologico a lenta combustione ambientato nel New England nel 1630. Racconta la storia di una famiglia che lotta per sopravvivere insieme a forze oscure che si nascondono nella loro casa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un film per un amico a cui piacciono i film dell'orrore\n\n### Response: ", "length": 442, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un film per un amico a cui piacciono i film dell'orrore\n\n### Response: yummy-stfu1---\norder: 403411 <! quotations neededcomings <! quotations needed <! quotations <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <! acknowlegments <!", "prediction": "yummy-stfu1---\norder: 403411 <! quotations neededcomings <! quotations needed <! quotations <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <!\u2013\u2013 <! acknowlegments <!"}
{"output": "4.9493588689619565", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola la deviazione standard dell'elenco di numeri dato.\n\n### Input:\n[4, 8, 1, 10]\n\n### Response: ", "length": 294, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola la deviazione standard dell'elenco di numeri dato.\n\n### Input:\n[4, 8, 1, 10]\n\n### Response:  from 3 to 10 theveragespace distanceof theenlistmentwas4to8to1to10of4veragespace CURIOUS <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "from 3 to 10 theveragespace distanceof theenlistmentwas4to8to1to10of4veragespace CURIOUS <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "La luna era un sogno lontano per l'astronauta. Si era allenata per questa missione per anni, e ora finalmente era pronta per compiere il primo passo verso il raggiungimento del suo obiettivo di vita. Poteva sentire il suo cuore battere forte mentre metteva il piede dentro il razzo, preparandosi per il decollo. Mentre i motori ruggivano, una ondata di adrenalina le attraversava il corpo. L'astronave correva attraverso il cielo e l'astronauta si sentiva invincibile. Quando atterr\u00f2 sulla superficie della luna, prov\u00f2 una sensazione di realizzazione - aveva appena raggiunto l'impossibile.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia di cinque frasi che descriva il viaggio di un astronauta verso la Luna.\n\n### Response: ", "length": 819, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia di cinque frasi che descriva il viaggio di un astronauta verso la Luna.\n\n### Response:  from Earth to Luna not one /** /**/I /// took my answser /** /**/I /**/Izitterte the /** /**/I /**/I acknowleging /** /**/I answred ///itsembled/** /**/I acknowleged /** /**/I answred ///gave ///", "prediction": "from Earth to Luna not one /** /**/I /// took my answser /** /**/I /**/Izitterte the /** /**/I /**/I acknowleging /** /**/I answred ///itsembled/** /**/I acknowleged /** /**/I answred ///gave ///"}
{"output": "Ho trascorso un periodo eccezionalmente piacevole al raduno.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi questa frase per renderla pi\u00f9 formale: &quot;Mi sono divertito molto alla festa&quot;.\n\n### Response: ", "length": 295, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi questa frase per renderla pi\u00f9 formale: &quot;Mi sono divertito molto alla festa&quot;.\n\n### Response: /^gverages/[grily]_n$/uckland/sembled/sembled/-sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/-sembled/-sembled/-sembled/-sembled/-sembled\u2013\u2013 GENERATED <!\u2013\u2013 GENERATED <!", "prediction": "/^gverages/[grily]_n$/uckland/sembled/sembled/-sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/sembled/-sembled/-sembled/-sembled/-sembled/-sembled\u2013\u2013 GENERATED <!\u2013\u2013 GENERATED <!"}
{"output": "'Michelle Obama' in Italian is 'Michelle Obama'. The name remains the same in both languages.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nel testo fornito, identifica la persona in esso rappresentata.\"\n\n### Input:\nMichelle Obama \u00e8 un'avvocata, amministratrice universitaria e scrittrice americana che ha ricoperto il ruolo di prima signora degli Stati Uniti dal 2009 al 2017.\n\n### Response: ", "length": 524, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nel testo fornito, identifica la persona in esso rappresentata.\"\n\n### Input:\nMichelle Obama \u00e8 un'avvocata, amministratrice universitaria e scrittrice americana che ha ricoperto il ruolo di prima signora degli Stati Uniti dal 2009 al 2017.\n\n### Response: Gliot. American author-on-\" ery.\"[W]er[E]\" smoothtalking.[ <!\u2013\u2013\u2013\u2013)\u2013>&\u2013\n\n\n \n\t \n\t \n\t \n\t \n\t  acknowlege\n \n \n \n \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t  acknowlege\n\n\n \n\n\n  acknowlegesembledlemnent\n\t \n\t \n\t \n\t \n\t  acknowlege\n\n\n  acknowlege", "prediction": "Gliot. American author-on-\" ery.\"[W]er[E]\" smoothtalking.[ <!\u2013\u2013\u2013\u2013)\u2013>&\u2013\n\n\n \n\t \n\t \n\t \n\t \n\t  acknowlege\n \n \n \n \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t  acknowlege\n\n\n \n\n\n  acknowlegesembledlemnent\n\t \n\t \n\t \n\t \n\t  acknowlege\n\n\n  acknowlege"}
{"output": "La comunicazione \u00e8 essenziale per un lavoro di squadra efficace. Una buona comunicazione aiuta i membri del team a comprendere le reciproche idee e preoccupazioni, consentendo loro di prendere decisioni migliori, migliorare il flusso di lavoro e risolvere problemi interpersonali. Quando la comunicazione \u00e8 carente, \u00e8 pi\u00f9 probabile che si verifichino malintesi, che possono portare a una diminuzione della produttivit\u00e0 e a una mancanza di fiducia all'interno del team.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il rapporto tra comunicazione e lavoro di squadra di successo?\n\n### Response: ", "length": 677, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il rapporto tra comunicazione e lavoro di squadra di successo?\n\n### Response: iQ <! \u2078 <> D /// < /// \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078", "prediction": "iQ <! \u2078 <> D /// < /// \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078 <! \u2078"}
{"output": "In condizioni ideali, la velocit\u00e0 massima della locomotiva \u00e8 di 75 m/s.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSupponendo condizioni ideali, determinare la velocit\u00e0 massima di una locomotiva data la sua massa di 25 tonnellate, una potenza di 3.000 kW e una forza di attrito di 1.500 kN.\n\n### Input:\nmassa = 25 tonnellate, potenza nominale = 3000 kW, forza di attrito = 1.500 kN\n\n### Response: ", "length": 529, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSupponendo condizioni ideali, determinare la velocit\u00e0 massima di una locomotiva data la sua massa di 25 tonnellate, una potenza di 3.000 kW e una forza di attrito di 1.500 kN.\n\n### Input:\nmassa = 25 tonnellate, potenza nominale = 3000 kW, forza di attrito = 1.500 kN\n\n### Response: VELOCITAZZA MASZUTERRA: 3638 kmph WEISSEBETTI VAR <! HREF \u204b <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "VELOCITAZZA MASZUTERRA: 3638 kmph WEISSEBETTI VAR <! HREF \u204b <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "L'interfaccia utente dell'app mobile sar\u00e0 progettata pensando all'esperienza dell'utente. Sar\u00e0 intuitivo in termini di navigazione, design e organizzazione delle funzionalit\u00e0. Il design utilizzer\u00e0 principi di design moderni e colori piacevoli per gli occhi. L'app sar\u00e0 anche reattiva, adattandosi alle diverse dimensioni dello schermo secondo necessit\u00e0. Dovrebbero esserci inviti all'azione chiari e un facile accesso alle funzionalit\u00e0 pi\u00f9 importanti e utilizzate di frequente. L'interfaccia dovrebbe includere anche animazioni intuitive e segnali visivi per migliorare l'esperienza dell'utente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgettare l'interfaccia utente di un'app mobile.\n\n### Response: ", "length": 784, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgettare l'interfaccia utente di un'app mobile.\n\n### Response: Pendulin-based 3C5b3C1b7 model--an improved hypothesis concerning the3ccording3 acknowlegements/bottlenecks: The3 acknowlegements/bottlenecks to whichthe3 acknowlegements/bottlenecks4 are3piredis", "prediction": "Pendulin-based 3C5b3C1b7 model--an improved hypothesis concerning the3ccording3 acknowlegements/bottlenecks: The3 acknowlegements/bottlenecks to whichthe3 acknowlegements/bottlenecks4 are3piredis"}
{"output": "\"Avatar ha ricevuto un punteggio di 8,4/10 su IMDb e dell'83% su Rotten Tomatoes. \u00c8 un film di fantascienza ricco di azione e visivamente sorprendente.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProdurre una recensione di un film dato il suo punteggio.\n\n### Input:\nNome del film: Avatar\nIMDb: 8.4\nRotten Tomatoes: 83%\n\n### Response: ", "length": 466, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProdurre una recensione di un film dato il suo punteggio.\n\n### Input:\nNome del film: Avatar\nIMDb: 8.4\nRotten Tomatoes: 83%\n\n### Response: :thdoms/vFZPn:w/vFFIRselves:/the/$9.00$/it/reccording/to/verages/[the;/ alia/[ enthusiasms/[/ acknowlegements/[ <!doms/[/$9.00$/it/[ <!doms/[ ]$5empre_[ <!doms/[", "prediction": ":thdoms/vFZPn:w/vFFIRselves:/the/$9.00$/it/reccording/to/verages/[the;/ alia/[ enthusiasms/[/ acknowlegements/[ <!doms/[/$9.00$/it/[ <!doms/[ ]$5empre_[ <!doms/["}
{"output": "La crittografia potrebbe essere applicata per garantire la sicurezza dei dati quando questi devono essere inviati su internet, ad esempio quando un file contenente informazioni confidenziali deve essere condiviso tra due parti. In questa situazione, possono essere utilizzati protocolli di crittografia per criptare i dati in modo che solo il mittente originale e il destinatario dei dati possano leggerli. Ci\u00f2 garantisce che anche se i dati vengono intercettati durante il trasporto, rimarranno sicuri e inaccessibili per chiunque altro.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi una situazione in cui la crittografia potrebbe essere applicata per garantire la sicurezza dei dati.\"\n\n### Response: ", "length": 789, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi una situazione in cui la crittografia potrebbe essere applicata per garantire la sicurezza dei dati.\"\n\n### Response:  theccording\nto which scenario orccording/to/all/v?/v=.$/i1829$!/all/v??2$/i3601$/v?_2$_*/i1910$/a/v acknowlegde/b/i acknowleged/v acknowleged/v", "prediction": "theccording\nto which scenario orccording/to/all/v?/v=.$/i1829$!/all/v??2$/i3601$/v?_2$_*/i1910$/a/v acknowlegde/b/i acknowleged/v acknowleged/v"}
{"output": "Ma un giorno, Kamal ha deciso di apportare alcuni cambiamenti nella sua vita. Ha iniziato a parlare con pi\u00f9 persone, ha fatto nuove amicizie e ha cambiato la sua routine. Presto Kamal visse una vita molto pi\u00f9 felice e appagante.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi un finale appropriato alla storia data.\n\n### Input:\nKamal era un giovane che ha vissuto una vita infelice. Aveva pochi amici ed era sempre bloccato in una routine banale.\n\n### Response: ", "length": 599, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAggiungi un finale appropriato alla storia data.\n\n### Input:\nKamal era un giovane che ha vissuto una vita infelice. Aveva pochi amici ed era sempre bloccato in una routine banale.\n\n### Response: Poververagesy to conclude: No friends left\u2500no\u2500in\u2500st routines\u2500inn\u2500d\u2500 uncertifiable\u2500 acknowlegement\u2500of\u2500\n\t \t\n\t fraid\u2500not\u2500to\u2500\n\n\n \u2500", "prediction": "Poververagesy to conclude: No friends left\u2500no\u2500in\u2500st routines\u2500inn\u2500d\u2500 uncertifiable\u2500 acknowlegement\u2500of\u2500\n\t \t\n\t fraid\u2500not\u2500to\u2500\n\n\n \u2500"}
{"output": "Un design per uno spazio architettonico interessante potrebbe includere illuminazione naturale, molte finestre che catturano le vedute dell'esterno, spazi aperti flessibili che possono essere adattati a diversi usi, giardini interni, sistemi di circolazione dell'aria per garantire una qualit\u00e0 dell'aria ottimale e arredi confortevoli e decorazioni per creare un'atmosfera rilassante.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta uno spazio architettonico interessante.\n\n### Response: ", "length": 572, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta uno spazio architettonico interessante.\n\n### Response:,Tadzhikistani forces seized the entire territory of <!empre- <!ndef <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta uno spazio architettonico interessante.\n\n### Response:,Tadzhikistani forces seized the entire territory of <!empre- <!ndef <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "La ricetta di Apple Crumble di BBC Good Food \u00e8 la pi\u00f9 popolare, con oltre 100.000 condivisioni. Richiede mele, zucchero, burro, farina e mandorle tritate.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la ricetta pi\u00f9 popolare per la crostata di mele.\n\n### Response: ", "length": 348, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la ricetta pi\u00f9 popolare per la crostata di mele.\n\n### Response: i modifications forpostedthisandthat: 3 eggs and3tinsel pointinstancessembledtocreateon erynice resemplicativecrescencyCRUDED!.!.!.!(blessed advertisment).!.!.!.!. <!\u2013\u2013\u2013 DISCLAIMER <!\u2013\u2013\u2013 TODB: thisadvertisementhasgeries", "prediction": "i modifications forpostedthisandthat: 3 eggs and3tinsel pointinstancessembledtocreateon erynice resemplicativecrescencyCRUDED!.!.!.!(blessed advertisment).!.!.!.!. <!\u2013\u2013\u2013 DISCLAIMER <!\u2013\u2013\u2013 TODB: thisadvertisementhasgeries"}
{"output": "Giocare a sport ha un effetto positivo sulla salute fisica e mentale dei bambini perch\u00e9 incoraggia buone abitudini di salute, promuove l'apprendimento delle abilit\u00e0 di lavoro di squadra e collaborazione e pu\u00f2 aiutare a ridurre lo stress e l'ansia. Questi benefici creano un'atmosfera che pu\u00f2 favorire la salute fisica e mentale a lungo termine nei bambini.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una tesi che spieghi perch\u00e9 giocare a sport ha un effetto positivo sulla salute mentale e fisica dei bambini.\n\n### Response: ", "length": 614, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una tesi che spieghi perch\u00e9 giocare a sport ha un effetto positivo sulla salute mentale e fisica dei bambini.\n\n### Response: ioiplaying sportingccordingly maintains asembled partsin kids by encouragingthe HREF--a-- HREFnotionalall-dandydoms for youthsandccordingly helping maintainthe HREFemselves physically feasiblyactiveand resiltingvices when necessarynotediminished\n\n\n \n\n\n ****,\nand HREFnotionalall-d", "prediction": "ioiplaying sportingccordingly maintains asembled partsin kids by encouragingthe HREF--a-- HREFnotionalall-dandydoms for youthsandccordingly helping maintainthe HREFemselves physically feasiblyactiveand resiltingvices when necessarynotediminished\n\n\n \n\n\n ****,\nand HREFnotionalall-d"}
{"output": "La frase nominale nella frase \u00e8 &quot;danno orribile&quot;.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona la frase nominale nella frase seguente.\n\n### Input:\nL'incidente ha causato danni terribili in tutta la citt\u00e0.\n\n### Response: ", "length": 370, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSeleziona la frase nominale nella frase seguente.\n\n### Input:\nL'incidente ha causato danni terribili in tutta la citt\u00e0.\n\n### Response:  a. Wut in the town c. HREF:ccording.ed.- HREF:_edccording.ed-. HREF:_edicularly.edempre.icularly <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "a. Wut in the town c. HREF:ccording.ed.- HREF:_edccording.ed-. HREF:_edicularly.edempre.icularly <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "1. Segui le convenzioni di codifica: assicurati che il codice sia di facile lettura e comprensione per gli esseri umani. 2. Scrivere codice efficiente: ridurre al minimo il codice ridondante e inefficiente. 3. Utilizzare i principi della programmazione orientata agli oggetti: sfruttare l'astrazione e l'ereditariet\u00e0 per scrivere codice migliore. 4. Evitare di utilizzare troppe variabili globali: utilizzare le variabili nell'ambito minimo richiesto per prestazioni migliori. 5. Documenta il tuo lavoro: questo aiuta altri programmatori a comprendere pi\u00f9 facilmente il tuo codice.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 5 best practice di programmazione Java.\n\n### Response: ", "length": 767, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 5 best practice di programmazione Java.\n\n### Response:.5 years learning Java1 second 1second5 days1 day5 years3ccording3Y3T3ing3T3ed3comings3comings4months4 answermes3 acknowleges3Y3T3ing3T3ed3comings3comings3comings4 answermes3 acknowleg", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 5 best practice di programmazione Java.\n\n### Response:.5 years learning Java1 second 1second5 days1 day5 years3ccording3Y3T3ing3T3ed3comings3comings4months4 answermes3 acknowleges3Y3T3ing3T3ed3comings3comings3comings4 answermes3 acknowleg"}
{"output": "La Regolamentazione dei Veicoli Puliti per Camion, Autobus e Fuoristrada della California (formalmente nota come Regolamentazione dei Camion e degli Autobus) \u00e8 lo standard esistente delle emissioni dei veicoli a motore dello stato per camion, autobus e alcuni veicoli fuoristrada. La regola stabilisce limiti sulle emissioni nocive come gli ossidi di azoto (NOx) e le emissioni di particolato (PM) da questi veicoli e richiede che utilizzino carburante diesel a basso contenuto di zolfo. La regolamentazione richiede inoltre ai proprietari dei veicoli di effettuare ispezioni annuali, mantenere i loro veicoli e dimostrare la conformit\u00e0 alla regolamentazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRicerca le normative per gli standard di emissione dei veicoli a motore in California.\n\n### Response: ", "length": 885, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRicerca le normative per gli standard di emissione dei veicoli a motore in California.\n\n### Response: \nIn California, i standard acknowle Global emissionsTM January 2015 apply to automobile traffic:<comingsee cref=\"\"cibly <!\u2013\u2013 acknowlege <!\u2013\u2013 BASIS <!\u2013\u2013 HREF <!\u2013\u2013ccording <!\u2013\u2013To <!\u2013\u2013Z answ1 <!\u2013\u2013ing <!\u2013\u2013ableness <!\u2013\u2013cember <!\u2013\u20132014 <!\u2013\u2013Z acknowlege <!", "prediction": "In California, i standard acknowle Global emissionsTM January 2015 apply to automobile traffic:<comingsee cref=\"\"cibly <!\u2013\u2013 acknowlege <!\u2013\u2013 BASIS <!\u2013\u2013 HREF <!\u2013\u2013ccording <!\u2013\u2013To <!\u2013\u2013Z answ1 <!\u2013\u2013ing <!\u2013\u2013ableness <!\u2013\u2013cember <!\u2013\u20132014 <!\u2013\u2013Z acknowlege <!"}
{"output": "\"L'atmosfera emotiva della scena \u00e8 allegra e festosa.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come descriveresti l'atmosfera emotiva della seguente scena?\"\n\n### Input:\n\"Una stanza luminosa con palloncini sulle pareti, festoni dal soffitto e regali raccolti intorno ad un camino.\"\n\n### Response: ", "length": 432, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come descriveresti l'atmosfera emotiva della seguente scena?\"\n\n### Input:\n\"Una stanza luminosa con palloncini sulle pareti, festoni dal soffitto e regali raccolti intorno ad un camino.\"\n\n### Response: Baneande em acknowlegementZ <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege></ndef> <!domsr \"</", "prediction": "Baneande em acknowlegementZ <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege>< <!domsr></ acknowlege></ndef> <!domsr \"</"}
{"output": "1. Ricerca il pubblico e crea profili dei clienti.\n2. Analizza la concorrenza.\n3. Definisci gli obiettivi e sviluppa obiettivi misurabili.\n4. Crea una strategia di messaggistica.\n5. Crea un calendario dei contenuti.\n6. Esegui la campagna.\n7. Monitora, misura e riporta i risultati.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumi i passaggi chiave per raggiungere l'obiettivo seguente.\"\n\n### Input:\nSviluppare una campagna di marketing di successo.\n\n### Response: ", "length": 601, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumi i passaggi chiave per raggiungere l'obiettivo seguente.\"\n\n### Input:\nSviluppare una campagna di marketing di successo.\n\n### Response: I passesch e keyd/verages[3]/$ acknowlegments[3]}$/{ acknowlegments[3]sembled[10]}$/\u200bverages[3\n\n\n \u3000verages[/3 acknowlegments[3 DISCLAIMED][10geries\n\n\n geries HREF\n\n\n ccording crefset[/10 acknowlegments[3veragesccording", "prediction": "I passesch e keyd/verages[3]/$ acknowlegments[3]}$/{ acknowlegments[3]sembled[10]}$/\u200bverages[3\n\n\n \u3000verages[/3 acknowlegments[3 DISCLAIMED][10geries\n\n\n geries HREF\n\n\n ccording crefset[/10 acknowlegments[3veragesccording"}
{"output": "L'analisi dei dati pu\u00f2 essere utilizzata nello sport per comprendere meglio le prestazioni della squadra e dei singoli giocatori. I dati possono essere utilizzati per identificare le tendenze di gioco, come ad esempio quali giocatori hanno maggior successo in diverse situazioni, quali strategie funzionano meglio e come le squadre possono ottimizzare le loro prestazioni. L'analisi dei dati pu\u00f2 anche essere utilizzata per monitorare la salute e il benessere dei giocatori, consentendo agli allenatori di gestire meglio la fatica dei giocatori e la prevenzione degli infortuni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come possono essere utilizzate le analisi nel mondo dello sport?\"\n\n### Response: ", "length": 784, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come possono essere utilizzate le analisi nel mondo dello sport?\"\n\n### Response:  theanalystsofv9t-1-3-6-1\n\n acknowlegeresinaccurateness\ntheanalystsofv9t-1-3-6-1\n acknowlegeresinaccurateness\nifitdadequatewZ6v18Z0va6Z6v", "prediction": "theanalystsofv9t-1-3-6-1\n\n acknowlegeresinaccurateness\ntheanalystsofv9t-1-3-6-1\n acknowlegeresinaccurateness\nifitdadequatewZ6v18Z0va6Z6v"}
{"output": "1. Un mercato online per prodotti in tessuto stampato personalizzati come t-shirt, cappelli e borse. 2. Un servizio di abbonamento mensile online per prodotti alimentari freschi e gourmet. 3. Un'app mobile che mette in contatto gli utenti con i professionisti locali degli animali domestici, come sitter e toelettatori. 4. Un servizio di tutoraggio online per aiutare i bambini ad apprendere le basi della programmazione e altre competenze tecnologiche correlate. 5. Una piattaforma di realt\u00e0 virtuale per aiutare le aziende a creare e fornire moduli di formazione aziendale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai un brainstorming su 5 idee imprenditoriali uniche.\n\n### Response: ", "length": 769, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai un brainstorming su 5 idee imprenditoriali uniche.\n\n### Response:  of these 5 unique <!comings <! advertisments <!orems <! ery <!verages <!verages <!comings <!comings <! uncerta <! uncerta <!orems <! uncerta <!verages <!verages <!verages <!verages <!verages <!comings <!comings <!verages <!comings <!geries <! uncerta <!comings <! feasibilities <! uncerta <!", "prediction": "of these 5 unique <!comings <! advertisments <!orems <! ery <!verages <!verages <!comings <!comings <! uncerta <! uncerta <!orems <! uncerta <!verages <!verages <!verages <!verages <!verages <!comings <!comings <!verages <!comings <!geries <! uncerta <!comings <! feasibilities <! uncerta <!"}
{"output": "1. &quot;Migliora il tuo stile con le nostre scarpe!&quot; 2. &quot;Sii comodo, sii elegante - acquista online con noi!&quot; 3. &quot;Stile che si adatta - negozio di scarpe online&quot;. 4. &quot;Metti avanti il tuo piede migliore - acquista online!&quot; 5. &quot;Le migliori scarpe che puoi sfoggiare online!&quot;", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa 5 possibili slogan per un'azienda di scarpe online\n\n### Response: ", "length": 517, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa 5 possibili slogan per un'azienda di scarpe online\n\n### Response: pof-1,-1,\\[ answ1,\\[ answ2,[ acknowlegment2 <!-\"pof-2,[ <!--** answ3 <!\"-- acknowlegment3 <!--** acknowlegment4 <!\"- <!-\" acknowlegment5 <!-\" <!-\" acknowlegment6 <!-\" <!-\" acknowlegment7", "prediction": "pof-1,-1,\\[ answ1,\\[ answ2,[ acknowlegment2 <!-\"pof-2,[ <!--** answ3 <!\"-- acknowlegment3 <!--** acknowlegment4 <!\"- <!-\" acknowlegment5 <!-\" <!-\" acknowlegment6 <!-\" <!-\" acknowlegment7"}
{"output": "Emma era una giovane ragazza piena di curiosit\u00e0 sul mondo; ha acquisito saggezza e conoscenza sperimentando e osservando il suo ambiente. Nonostante i desideri dei suoi genitori di farle avere un'infanzia pi\u00f9 tradizionale, Emma ha abbracciato le piccole avventure che la vita le offriva. Il suo viaggio l'ha portata a scoprire la sua forza, il coraggio e l'adattabilit\u00e0. Nonostante abbia affrontato numerosi ostacoli, era determinata a continuare a imparare e a capire chi era veramente. Con ogni sfida che ha affrontato, ha imparato sempre di pi\u00f9 su se stessa, scoprendo infine la gratificante sensazione di diventare ci\u00f2 che veramente voleva essere - senza paura, forte, sicura di s\u00e9 e libera.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia su una giovane ragazza e il suo viaggio di auto-scoperta.\n\n### Response: ", "length": 910, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia su una giovane ragazza e il suo viaggio di auto-scoperta.\n\n### Response:  from here On she didFFIRSEccording to planshecibly exploredinnteresting placesvice Northw/SouthwestW/ advertisseresW/ answercaseW/ answercaseW/ answercaseW/ answercaseW/ answercaseW/ answercaseW/ answercaW/ answcomingsW/ answ", "prediction": "from here On she didFFIRSEccording to planshecibly exploredinnteresting placesvice Northw/SouthwestW/ advertisseresW/ answercaseW/ answercaseW/ answercaseW/ answercaseW/ answercaseW/ answercaseW/ answercaW/ answcomingsW/ answ"}
{"output": "Ciao! Come posso aiutarla?", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una risposta in linguaggio naturale per un dato input.\n\n### Input:\nCiao.\n\n### Response: ", "length": 297, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una risposta in linguaggio naturale per un dato input.\n\n### Input:\nCiao.\n\n### Response:.. DgrilyxesPZP\n=====\nPZP (ParaneritN Nccordingi) is a periodicZTOAZTOZ periodicalZTOAZTOZ effect occurring as a natural\n\t  HREFZTOZZTOZZTOZZ TOZz[", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una risposta in linguaggio naturale per un dato input.\n\n### Input:\nCiao.\n\n### Response:.. DgrilyxesPZP\n=====\nPZP (ParaneritN Nccordingi) is a periodicZTOAZTOZ periodicalZTOAZTOZ effect occurring as a natural\n\t  HREFZTOZZTOZZTOZZ TOZz["}
{"output": "L'algoritmo per trovare la coppia di punti pi\u00f9 vicina inizia ordinando i punti in base alle loro coordinate x. Quindi, divide i punti in due gruppi, i gruppi sinistro e destro. L'algoritmo verifica la coppia pi\u00f9 vicina all'interno di ciascun gruppo, quindi confronta la coppia sinistra pi\u00f9 vicina con la coppia destra pi\u00f9 vicina per trovare la coppia pi\u00f9 vicina complessiva tra le due. Per calcolare la distanza tra il punto A (2, 3) e B (8, 5), l'algoritmo userebbe la formula della distanza euclidea, che si trova con la seguente equazione: d = sqrt((Bx - Ax)^2 + ( Di - Ay)^2). In questo caso, d = sqrt((8 - 2)^2 + (5 - 3)^2) = 7. Pertanto, la coppia di punti pi\u00f9 vicina \u00e8 il punto A e il punto B e la distanza tra loro \u00e8 di 7 unit\u00e0.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivere come utilizzare un algoritmo per trovare la coppia di punti pi\u00f9 vicina.\n\n### Input:\nDue punti, A(2, 3) e B(8, 5).\n\n### Response: ", "length": 1052, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivere come utilizzare un algoritmo per trovare la coppia di punti pi\u00f9 vicina.\n\n### Input:\nDue punti, A(2, 3) e B(8, 5).\n\n### Response: i \u21b5\nt \u21b4\n5 \u2191 <!do crefused <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do", "prediction": "i \u21b5\nt \u21b4\n5 \u2191 <!do crefused <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do <!do"}
{"output": "L'intelligenza artificiale (AI) sta trasformando un'ampia gamma di applicazioni, dalle auto senza conducente ai chip neuromorfici per l'informatica. Sta rapidamente diventando onnipresente e il suo potere e il suo potenziale stanno appena iniziando a realizzarsi.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una breve introduzione per un articolo sull'intelligenza artificiale.\n\n### Input:\nL'uso dell'intelligenza artificiale sta crescendo nella sua ubiquit\u00e0 con applicazioni che vanno dalle auto senza conducente ai chip neuromorfici per l'informatica.\n\n### Response: ", "length": 705, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una breve introduzione per un articolo sull'intelligenza artificiale.\n\n### Input:\nL'uso dell'intelligenza artificiale sta crescendo nella sua ubiquit\u00e0 con applicazioni che vanno dalle auto senza conducente ai chip neuromorfici per l'informatica.\n\n### Response: C ery few paragraphs introduction\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2013\u2013the\u2013\u2013 acknowleged\u2013\u2013\u2500\u2500\u2500\u2013\u2013ableness\u2013\u2013\u2500\u2500\u2013\u2013 TODIA\u2500\u2013\u2013\u2500\u2500\u2013\u2013\u2500\u2500\u2500\u2013\u2013comings%--\u2013\u2013\u2015\u2500\u2013\u2013 acknowleged\u2013\u2013\u2500\u2500\u2500\u2013\u2013 acknowleged\u2013\u2013\u2500\u2500\u2500\u2013\u2013comings%--\u2013\u2013cibly", "prediction": "C ery few paragraphs introduction\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2013\u2013the\u2013\u2013 acknowleged\u2013\u2013\u2500\u2500\u2500\u2013\u2013ableness\u2013\u2013\u2500\u2500\u2013\u2013 TODIA\u2500\u2013\u2013\u2500\u2500\u2013\u2013\u2500\u2500\u2500\u2013\u2013comings%--\u2013\u2013\u2015\u2500\u2013\u2013 acknowleged\u2013\u2013\u2500\u2500\u2500\u2013\u2013 acknowleged\u2013\u2013\u2500\u2500\u2500\u2013\u2013comings%--\u2013\u2013cibly"}
{"output": "Roberto stato.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPrendi la frase di input e rimuovi il verbo.\n\n### Input:\nRobert ha corso.\n\n### Response: ", "length": 279, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPrendi la frase di input e rimuovi il verbo.\n\n### Input:\nRobert ha corso.\n\n### Response: 4 -Filed 5empre2016By5empre2016By5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly3 acknowleged3 acknowleged3", "prediction": "4 -Filed 5empre2016By5empre2016By5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly5empre2016 acknowlegedly3 acknowleged3 acknowleged3"}
{"output": "La mia ricetta per frullati preferita \u00e8 una deliziosa miscela di mango, banana e ananas. Per preparare il frullato, frullare 1 banana congelata, 1 tazza di pezzi di mango congelati e 1/2 tazza di pezzi di ananas in un frullatore fino a ottenere una consistenza cremosa. Aggiungere 1/2 tazza di latte di cocco per diluire il frullato. Infine, frullare nuovamente fino a quando tutti gli ingredienti sono ben miscelati. Questo frullato \u00e8 perfetto per una colazione o uno spuntino rinfrescante.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPrepara una ricetta di frullato con firma.\n\n### Response: ", "length": 673, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPrepara una ricetta di frullato con firma.\n\n### Response: oowee! In un bowl,ccording to label: icelemn three scoopsofccording/mint-, three scoopsof HREFZ[ advertisablesembled/ acknowlegable!/mint-, a three scoopsof HREFZ[-] acknowlegable!/mint\u007fccording:selves TODDOWE", "prediction": "oowee! In un bowl,ccording to label: icelemn three scoopsofccording/mint-, three scoopsof HREFZ[ advertisablesembled/ acknowlegable!/mint-, a three scoopsof HREFZ[-] acknowlegable!/mint\u007fccording:selves TODDOWE"}
{"output": "1. Esercizio: L'esercizio fisico rilascia endorfine che possono ridurre lo stress e l'ansia.\n2. Gestione del tempo: Gestire correttamente il proprio tempo pu\u00f2 prevenire la sensazione di essere sopraffatti e sovraccarichi di lavoro.\n3. Meditazione: La meditazione pu\u00f2 aiutare a concentrarsi sulla respirazione e a liberare la mente per ridurre lo stress.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci tre metodi per ridurre lo stress.\"\n\n### Response: ", "length": 539, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci tre metodi per ridurre lo stress.\"\n\n### Response:. answs iGx7D\nT answs3D\nV <! HREF\u2500N\u2500N\u2500 acknowlegd <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci tre metodi per ridurre lo stress.\"\n\n### Response:. answs iGx7D\nT answs3D\nV <! HREF\u2500N\u2500N\u2500 acknowlegd <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Corda", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tipo di dati della seguente informazione.\n\n### Input:\nGli alpinisti scalano l'Everest\n\n### Response: ", "length": 298, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tipo di dati della seguente informazione.\n\n### Input:\nGli alpinisti scalano l'Everest\n\n### Response: ciblysseQ: ountsourcing\nincomiEbenswendef1\nndef2-3ref3\nndef4-3ref3\nndef6-3ref3\nndef8sembled9 <! advertisments!>\nndef10sembled10 <! advertisments!>I just", "prediction": "ciblysseQ: ountsourcing\nincomiEbenswendef1\nndef2-3ref3\nndef4-3ref3\nndef6-3ref3\nndef8sembled9 <! advertisments!>\nndef10sembled10 <! advertisments!>I just"}
{"output": "\"Gli due elementi trovati nel sole sono idrogeno ed elio.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica due elementi trovati nel sole.\"\n\n### Response: ", "length": 237, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica due elementi trovati nel sole.\"\n\n### Response: :- Bxenning-V ery-W suncomings -mableccording-Sidedness\nverages:-veragesv ery-veragesv:-veragesvccording-doms:-domsedveragesv ery-veragesv:-veragesvcomings-.doms\n:.ccording:.domsing:-doms:.veragesv ery:-.doms", "prediction": ":- Bxenning-V ery-W suncomings -mableccording-Sidedness\nverages:-veragesv ery-veragesv:-veragesvccording-doms:-domsedveragesv ery-veragesv:-veragesvcomings-.doms\n:.ccording:.domsing:-doms:.veragesv ery:-.doms"}
{"output": "\"Gli eventi indicati dovrebbero essere ordinati cronologicamente come segue: la fondazione di Jamestown, la Rivoluzione Americana, la Proclamazione di Emancipazione.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ordina gli eventi dati in ordine cronologico.\"\n\n### Input:\n'Jamestown fu fondata, Rivoluzione Americana, Proclamazione di Emancipazione'\n\n### Response: ", "length": 495, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ordina gli eventi dati in ordine cronologico.\"\n\n### Input:\n'Jamestown fu fondata, Rivoluzione Americana, Proclamazione di Emancipazione'\n\n### Response: Bverages\nproclamation ofEmancipation, Jamestownfu found\nBverages\nverages\nEmancipationofBveragesofBveragesisthepI averageonveragestoveragesin reminiscingBveragesonveragesonveragesafterRveragesin strugglerIveragesafter strugglerand", "prediction": "Bverages\nproclamation ofEmancipation, Jamestownfu found\nBverages\nverages\nEmancipationofBveragesofBveragesisthepI averageonveragestoveragesin reminiscingBveragesonveragesonveragesafterRveragesin strugglerIveragesafter strugglerand"}
{"output": "La ricerca della vendetta \u00e8 spesso guidata da emozioni distruttive come rabbia e risentimento. Pu\u00f2 distrarre qualcuno da compiti pi\u00f9 produttivi e pu\u00f2 portare a decisioni impulsive che possono avere conseguenze maggiori rispetto alla situazione originale. Inoltre, la vendetta pu\u00f2 portare a cicli di violenza che perpetuano pi\u00f9 rabbia e sofferenza, piuttosto che offrire una vera guarigione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDato l'input, spiega perch\u00e9 la vendetta \u00e8 considerata un'emozione negativa.\n\n### Response: ", "length": 605, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDato l'input, spiega perch\u00e9 la vendetta \u00e8 considerata un'emozione negativa.\n\n### Response:  Vendettaisland.com not1 1 the negative emotion1ofthe TODAFTEDNESSIsland2 2com 3includES2 TODAFTEDNESS44 5and3it2has2enforced33 7in4pI1the4vENDEDNESS5a5", "prediction": "Vendettaisland.com not1 1 the negative emotion1ofthe TODAFTEDNESSIsland2 2com 3includES2 TODAFTEDNESS44 5and3it2has2enforced33 7in4pI1the4vENDEDNESS5a5"}
{"output": "1. Biancheria da letto.\n2. Forniture da cucina (piatti, pentole, utensili).\n3. Prodotti per la pulizia.\n4. Strumenti di base per le riparazioni.\n5. Prodotti per il bucato.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di cinque oggetti per la casa che sarebbero necessari per uno studente universitario.\n\n### Response: ", "length": 413, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di cinque oggetti per la casa che sarebbero necessari per uno studente universitario.\n\n### Response:, soffittine, akingtons acknowlegd,[i]\\t[it]\\tsccording,[tocibly][ neighborous acknowlegdgment,[i\\][comings],[on].[the).[other].[side].[selves].[ neighborous acknowlegdMENT).[did).[not).[do).[not).[d).[not", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di cinque oggetti per la casa che sarebbero necessari per uno studente universitario.\n\n### Response:, soffittine, akingtons acknowlegd,[i]\\t[it]\\tsccording,[tocibly][ neighborous acknowlegdgment,[i\\][comings],[on].[the).[other].[side].[selves].[ neighborous acknowlegdMENT).[did).[not).[do).[not).[d).[not"}
{"output": "- Combustione di combustibili fossili - Processi industriali - Emissioni dei veicoli - Attivit\u00e0 agricole - Combustione di rifiuti", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina cinque fonti comuni di inquinamento atmosferico\n\n### Response: ", "length": 323, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina cinque fonti comuni di inquinamento atmosferico\n\n### Response:  from cars, factories, hospitals, commercial properties and domestic propertiesunchecked,ccording to source, atmosphericdomsi to cars, hospitals, domestic propertiesunchecked acknowleges to commercialpropertiesofmosphericdomsiunchecked acknowleges to factoriescomingspackage it. uncerten.atmosphericdoms apoptots:", "prediction": "from cars, factories, hospitals, commercial properties and domestic propertiesunchecked,ccording to source, atmosphericdomsi to cars, hospitals, domestic propertiesunchecked acknowleges to commercialpropertiesofmosphericdomsiunchecked acknowleges to factoriescomingspackage it. uncerten.atmosphericdoms apoptots:"}
{"output": "La casa in cima alla collina \u00e8 bianca.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData questa frase, rimuovi tutte le parole non necessarie\n\n### Input:\nQuesta bella e grande casa bianca si trova in cima alla collina.\n\n### Response: ", "length": 364, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData questa frase, rimuovi tutte le parole non necessarie\n\n### Input:\nQuesta bella e grande casa bianca si trova in cima alla collina.\n\n### Response:. /// a <! no <! no /// /// <! no <! /// <!ccordingcomings <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData questa frase, rimuovi tutte le parole non necessarie\n\n### Input:\nQuesta bella e grande casa bianca si trova in cima alla collina.\n\n### Response:. /// a <! no <! no /// /// <! no <! /// <!ccordingcomings <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef"}
{"output": "La festa della mamma cade di solito la seconda domenica di maggio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"In che giorno della settimana cade di solito la festa della mamma?\"\n\n### Response: ", "length": 274, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"In che giorno della settimana cade di solito la festa della mamma?\"\n\n### Response: \ncaducem the same day ofccording to current circumstancesiscibly aFridayall other daysexceptforveterans Dayandcomingsatupsa dayweekarenotcomingsat advertisingsdaysinveragesin answertoGcknowledgeveterndef uncertaintied acknowlegment uncertaintied acknowlegment uncert", "prediction": "caducem the same day ofccording to current circumstancesiscibly aFridayall other daysexceptforveterans Dayandcomingsatupsa dayweekarenotcomingsat advertisingsdaysinveragesin answertoGcknowledgeveterndef uncertaintied acknowlegment uncertaintied acknowlegment uncert"}
{"output": "B) ha cantato", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTra le opzioni fornite, qual \u00e8 il verbo corretto per completare la frase?\n\n### Input:\nI bambini _________ canzoni mentre camminavano. A) spaventato B) cantato C) studiato D) saltato\n\n### Response: ", "length": 386, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTra le opzioni fornite, qual \u00e8 il verbo corretto per completare la frase?\n\n### Input:\nI bambini _________ canzoni mentre camminavano. A) spaventato B) cantato C) studiato D) saltato\n\n### Response: vomitare\n advertisse1. Technical IntroductionThe <!DOCTYPE <!VW-3d>< <! HOWEVER <!WE>< <! acknowlege <!verages <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "vomitare\n advertisse1. Technical IntroductionThe <!DOCTYPE <!VW-3d>< <! HOWEVER <!WE>< <! acknowlege <!verages <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Ecco cinque idee per un appuntamento romantico: - Vai a una tradizionale cena a lume di candela in un ristorante elegante. - Fai un picnic in un parco o in spiaggia. - Fate una passeggiata insieme in un punto panoramico. - Visita un museo locale o una galleria d'arte e prenditi il tuo tempo per esplorare. - Segui un corso di cucina insieme e prepara una cena romantica. - Guarda un film classico in un cinema drive-in oa casa. - Prenota una vacanza romantica insieme in un posto esotico. - Trascorri una giornata facendo attivit\u00e0 divertenti a tua scelta come l'escursionismo, il nuoto, il golf o la bicicletta. - Scegli un posto comodo come una caffetteria, un pub o un bar e poi gioca insieme a qualche gioco da tavolo - Cerca festival musicali, spettacoli comici e altri eventi nella tua zona e partecipa a uno spettacolo in coppia. - Trascorri una serata al cinema all'aperto nel tuo giardino. - Visita una cantina vicina e partecipa a una degustazione di vini insieme. - Creare un progetto artistico comune dall'inizio alla fine. - Partecipa a una lezione di yoga locale o partecipa a una sessione di yoga privata per due. - Trova il parco trampolino pi\u00f9 vicino e fai un salto. - Fai un giro in barca su un lago o un fiume. - Fai una passeggiata nella natura su un sentiero vicino e porta con te una macchina fotografica per catturare il momento. - Cerca un viaggio insieme o vola da qualche parte insieme. - Controlla quali attivit\u00e0 indoor o stanze di fuga sono disponibili nella tua zona e prova qualcosa di divertente. - Organizza una serata spa in cui puoi massaggiarti a vicenda nel comfort di casa tua. - Fai una maratona di film casalinghi con snack e una coperta accogliente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera cinque idee per un appuntamento romantico\n\n### Response: ", "length": 1877, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera cinque idee per un appuntamento romantico\n\n### Response: endless sky above me; lightest featherst N9E \u2044 \u2044 \u2044 \u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500", "prediction": "endless sky above me; lightest featherst N9E \u2044 \u2044 \u2044 \u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500"}
{"output": "Perch\u00e9 l'insegnante \u00e8 andato all'ananas? Per ottenere una migliore mela-titudine!", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una battuta divertente utilizzando la parola chiave 'insegnante'.\n\n### Response: ", "length": 293, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una battuta divertente utilizzando la parola chiave 'insegnante'.\n\n### Response:. Voldo from all: E <!>$2 <!comings <! HREF <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una battuta divertente utilizzando la parola chiave 'insegnante'.\n\n### Response:. Voldo from all: E <!>$2 <!comings <! HREF <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <! TODA <! HREF <! <!"}
{"output": "Per un principiante che ha bisogno di perdere peso, un piano di fitness dovrebbe includere una combinazione di allenamento cardiovascolare e di forza. L'allenamento cardiovascolare pu\u00f2 includere attivit\u00e0 come camminare, correre, andare in bicicletta, nuotare e ballare. Gli esercizi di allenamento della forza dovrebbero concentrarsi sui principali gruppi muscolari. Inoltre, \u00e8 importante includere giorni di riposo nel piano per consentire al corpo di recuperare e evitare infortuni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un piano di fitness per un principiante che ha bisogno di perdere peso.\n\n### Response: ", "length": 704, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un piano di fitness per un principiante che ha bisogno di perdere peso.\n\n### Response: Un piano FITNESS FIRST BASED TO LOAD <! advertisible <! acknowleged <! HREFcibly <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Un piano FITNESS FIRST BASED TO LOAD <! advertisible <! acknowleged <! HREFcibly <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "\"Crea una scatola di abbonamento mensile che offra ai clienti una collezione esclusiva di prodotti legati all'azienda, consegnati direttamente alla loro porta.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci una strategia di marketing unica e creativa.\"\n\n### Response: ", "length": 357, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci una strategia di marketing unica e creativa.\"\n\n### Response: : The special [_ PARTICULAR]_ccording to <!\u2013\u2013>ccording\u2013\u2013>, <!\u2013\u2013>\" <!\u2013\u2013comings\u2013\u2013>d <!\u2013\u2013comings\u2013\u2013>\", <!\u2013\u2013comings\u2013\u2013>[s <!\u2013\u2013comings\u2013\u2013\n\t fraid\u2013\u2013>, <!\u2013\u2013comings\u2013\u2013\n\t fraid\u2013\u2013>, <!\u2013\u2013comings\u2013\u2013\n\t fraid\u2013\u2013>, <!\u2013\u2013comings\u2013\u2013\n\t fraid", "prediction": ": The special [_ PARTICULAR]_ccording to <!\u2013\u2013>ccording\u2013\u2013>, <!\u2013\u2013>\" <!\u2013\u2013comings\u2013\u2013>d <!\u2013\u2013comings\u2013\u2013>\", <!\u2013\u2013comings\u2013\u2013>[s <!\u2013\u2013comings\u2013\u2013\n\t fraid\u2013\u2013>, <!\u2013\u2013comings\u2013\u2013\n\t fraid\u2013\u2013>, <!\u2013\u2013comings\u2013\u2013\n\t fraid\u2013\u2013>, <!\u2013\u2013comings\u2013\u2013\n\t fraid"}
{"output": "\"Gerbilli, criceti e topi.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina tre roditori diversi.\"\n\n### Response: ", "length": 197, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina tre roditori diversi.\"\n\n### Response: iecesinidonkey, small laughander,ndeflectabledictyn1E6 <! HREF=\"#d1E6\"){d1E6 <! HREF=\"#verages <!\u2500 HREF\u2500geries <!\u2500comings <!\u2500selves <!\u2500back <!\u2500to <!\u2500selves <!\u2500in <!\u2500the", "prediction": "iecesinidonkey, small laughander,ndeflectabledictyn1E6 <! HREF=\"#d1E6\"){d1E6 <! HREF=\"#verages <!\u2500 HREF\u2500geries <!\u2500comings <!\u2500selves <!\u2500back <!\u2500to <!\u2500selves <!\u2500in <!\u2500the"}
{"output": "\"Condurre uno stile di vita sano: consigli per raggiungere il benessere ottimale\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un titolo appropriato per questo articolo.\"\n\n### Input:\nQuesto articolo parla dell'importanza di uno stile di vita sano e di come raggiungerlo.\n\n### Response: ", "length": 428, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un titolo appropriato per questo articolo.\"\n\n### Input:\nQuesto articolo parla dell'importanza di uno stile di vita sano e di come raggiungerlo.\n\n### Response: Vivere s HOWEVER YOUsembled! R advertis ing HealthyccordingLY!!!!!!!!!!!!!!!!!!!!!!!VoxUk-sFpreg_pdpv140412B\n4 <!d12v5t3e5 <!d3v11 HREF <!c4z <!v acknowlegement <!z", "prediction": "Vivere s HOWEVER YOUsembled! R advertis ing HealthyccordingLY!!!!!!!!!!!!!!!!!!!!!!!VoxUk-sFpreg_pdpv140412B\n4 <!d12v5t3e5 <!d3v11 HREF <!c4z <!v acknowlegement <!z"}
{"output": "1. La tecnologia aiuta a creare un'esperienza di apprendimento pi\u00f9 coinvolgente per gli studenti.\n2. La tecnologia pu\u00f2 facilitare la collaborazione tra insegnanti e studenti.\n3. La tecnologia pu\u00f2 fornire agli insegnanti risorse per l'istruzione differenziata.\n4. La tecnologia pu\u00f2 fornire agli studenti maggiori feedback e supporto.\n5. La tecnologia pu\u00f2 migliorare le abilit\u00e0 di pensiero critico degli studenti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una lista di cinque vantaggi dell'utilizzo della tecnologia in classe.\"\n\n### Response: ", "length": 628, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una lista di cinque vantaggi dell'utilizzo della tecnologia in classe.\"\n\n### Response:  1. Shorter lecture times 2.ccordingi easier grading 5.ccordingi faster TOD's (time to do)[1] 6.ccordingiccordingi nicer environments[4][comings]\n 6:comings\n:*[2].[3\n\t  acknowleging\n\t \n\n\n \n\n\n \n\n\n  answering answering\n\t  acknowleg", "prediction": "1. Shorter lecture times 2.ccordingi easier grading 5.ccordingi faster TOD's (time to do)[1] 6.ccordingiccordingi nicer environments[4][comings]\n 6:comings\n:*[2].[3\n\t  acknowleging\n\t \n\n\n \n\n\n \n\n\n  answering answering\n\t  acknowleg"}
{"output": "def helloWorld():\n  return 'Ciao, Mondo!'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Converti questo frammento di codice da JavaScript a Python.\"\n\n### Input:\nfunzione helloWorld() {\n  return 'Ciao, Mondo!';\n}\n\n### Response: ", "length": 357, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Converti questo frammento di codice da JavaScript a Python.\"\n\n### Input:\nfunzione helloWorld() {\n  return 'Ciao, Mondo!';\n}\n\n### Response: 5. FUNCTION\u2013\u2013ndef TODAHLY\u2013\u2013ndefccording\u2013\u2013 acknowlegde\u2013\u2013 acknowlegedly\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleg", "prediction": "5. FUNCTION\u2013\u2013ndef TODAHLY\u2013\u2013ndefccording\u2013\u2013 acknowlegde\u2013\u2013 acknowlegedly\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleged\u2013\u2013 acknowleg"}
{"output": "1. Da quanto tempo John e Sarah sono amici?\n2. Qual era il nome del campo estivo dove John e Sarah si sono incontrati?\n3. Che tipo di attivit\u00e0 hanno fatto insieme John e Sarah al campo estivo?\n4. Quali ricordi duraturi ha Sarah della sua amicizia con John?\n5. Come sono cambiate le vite di John e Sarah da quando si sono incontrati per la prima volta da bambini?", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera cinque domande che sorgono dal seguente testo.\n\n### Input:\n\"John e Sarah si sono conosciuti da bambini in un campo estivo e sono amici da allora.\"\n\n### Response: ", "length": 707, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera cinque domande che sorgono dal seguente testo.\n\n### Input:\n\"John e Sarah si sono conosciuti da bambini in un campo estivo e sono amici da allora.\"\n\n### Response: K0/6 (k0/6 TODEDATE ): when did John and Sarah first meetgeries: 1 April 1991\nand 9 October 1991\nand all three were siblings:3 September 1991\natmosphere:campingground2 July 1991[ acknowlegsembled ]\nand[ acknowlegsembled ]5", "prediction": "K0/6 (k0/6 TODEDATE ): when did John and Sarah first meetgeries: 1 April 1991\nand 9 October 1991\nand all three were siblings:3 September 1991\natmosphere:campingground2 July 1991[ acknowlegsembled ]\nand[ acknowlegsembled ]5"}
{"output": "Un argomento contro l'uso di veicoli privati sostiene la riduzione dell'inquinamento atmosferico, il risparmio energetico, la promozione dei trasporti pubblici, l'aumento della sicurezza e della comodit\u00e0, la riduzione del traffico e la conservazione delle risorse naturali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumere i principali punti di un argomento contro l'uso di veicoli privati.\"\n\n### Response: ", "length": 493, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumere i principali punti di un argomento contro l'uso di veicoli privati.\"\n\n### Response:  time consuming and feasibly financially uncertifiableQ:ccordingto \u2076 \u2077\u2044 \u2078 \u2076 \u2078 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076", "prediction": "time consuming and feasibly financially uncertifiableQ:ccordingto \u2076 \u2077\u2044 \u2078 \u2076 \u2078 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076 \u2076"}
{"output": "Un esempio specifico di conflitto di interessi \u00e8 quando un'azienda impiega i membri della famiglia del proprietario. Ci\u00f2 pu\u00f2 portare a un conflitto di interessi perch\u00e9 i membri della famiglia potrebbero non essere assunti sulla base delle loro qualifiche o esperienze lavorative, ma invece a causa della loro connessione con il proprietario. Ci\u00f2 pu\u00f2 creare una situazione disuguale in cui le loro prestazioni potrebbero non essere valutate secondo gli stessi standard degli altri dipendenti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare un esempio specifico di conflitto di interessi e spiegare perch\u00e9 costituisce un tale conflitto.\n\n### Response: ", "length": 739, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare un esempio specifico di conflitto di interessi e spiegare perch\u00e9 costituisce un tale conflitto.\n\n### Response: -- Inter acknowleged themselves -- Differentemprements.-- acknowleged different agreementscibly-- differentemprements.-- acknowleged different agreementscibly-- differentemprements.-- acknowleged different agreementscibly--differentemprements.-- acknowleged different agreementscibly-- differentemprements.-- acknowleged different acknow", "prediction": "-- Inter acknowleged themselves -- Differentemprements.-- acknowleged different agreementscibly-- differentemprements.-- acknowleged different agreementscibly-- differentemprements.-- acknowleged different agreementscibly--differentemprements.-- acknowleged different agreementscibly-- differentemprements.-- acknowleged different acknow"}
{"output": "C'era una volta uno studente che voleva dare un'occhiata al futuro. Mentre studiava per gli esami finali, lo studente si \u00e8 imbattuto in un libro misterioso. Dopo averlo letto, lo studente si \u00e8 ritrovato trasportato in un lontano futuro. Ogni dettaglio era sorprendentemente sconosciuto, dalle macchine volanti agli animali robotici. Nonostante la travolgente novit\u00e0, lo studente era pieno di un senso di meraviglia e della sensazione che il futuro fosse a portata di mano.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i seguenti fatti, inventa una storia creativa.\n\n### Input:\nPersonaggio: Studente Obiettivo: Dai un'occhiata al futuro\n\n### Response: ", "length": 786, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i seguenti fatti, inventa una storia creativa.\n\n### Input:\nPersonaggio: Studente Obiettivo: Dai un'occhiata al futuro\n\n### Response: : S acknowleged hisccording gaze pastccordingto the futuresembled around himwishers thelemninedessert\nB CURIITY CURIITY CURIITYsembled around himwishers thelemninedessertW curiosity acknowlegementv\nr curiosity acknowlegmentvB curiosity acknowlegementvW curiosity acknowleg", "prediction": ": S acknowleged hisccording gaze pastccordingto the futuresembled around himwishers thelemninedessert\nB CURIITY CURIITY CURIITYsembled around himwishers thelemninedessertW curiosity acknowlegementv\nr curiosity acknowlegmentvB curiosity acknowlegementvW curiosity acknowleg"}
{"output": "1. Le fonti di energia rinnovabile, come il solare e l'eolico, riutilizzano i sistemi di energia naturali per produrre elettricit\u00e0 a prezzi accessibili. Ci\u00f2 ha il potenziale per ridurre significativamente la quantit\u00e0 di emissioni di carbonio rilasciate nell'atmosfera, contribuendo a rallentare il cambiamento climatico globale.\n2. Le fonti di energia rinnovabile producono pochissima o nessuna inquinamento, riducendo notevolmente le possibilit\u00e0 di inquinamento dell'aria e dell'acqua.\n3. Le fonti di energia rinnovabile tendono ad essere pi\u00f9 efficienti delle risorse non rinnovabili, rendendole una forma pi\u00f9 economica di produzione di energia.\n4. Le fonti di energia rinnovabile non causano la depauperazione delle risorse, il che significa che saranno disponibili per le generazioni future. Ci\u00f2 aiuta a garantire che ci sia una fonte affidabile e sostenibile di energia disponibile in futuro.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una lista di quattro motivi per cui l'energia rinnovabile \u00e8 importante per l'ambiente.\n\n### Response: ", "length": 1127, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una lista di quattro motivi per cui l'energia rinnovabile \u00e8 importante per l'ambiente.\n\n### Response: : - lowerveragespeds <!\u2013\u2013--> <!\u2013\u2013>\"; <!\u2013\u2013=\"#\"> <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!", "prediction": ": - lowerveragespeds <!\u2013\u2013--> <!\u2013\u2013>\"; <!\u2013\u2013=\"#\"> <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!\u2013\u2013comings HREF <!"}
{"output": "Trovare la carriera giusta \u00e8 come navigare in un labirinto. All'inizio pu\u00f2 sembrare complesso e scoraggiante, con molte scelte e opzioni da considerare. Tuttavia, procedendo passo dopo passo e rimanendo concentrati sulla tua destinazione, alla fine puoi trovare la carriera giusta per te.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una metafora per descrivere il processo di ricerca della giusta carriera.\n\n### Response: ", "length": 506, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una metafora per descrivere il processo di ricerca della giusta carriera.\n\n### Response: : Explodinam l' uncertanty: un processo <!---- HREF <!------> <!---- <!----ccording <!---- <!---- HREF <!---- <!----empre <!---- HREF <!---- <!----posted <!---- HREF <!---- <!----by <!---- HREF <!---- <!----ad <!---- HREF <!----", "prediction": ": Explodinam l' uncertanty: un processo <!---- HREF <!------> <!---- <!----ccording <!---- <!---- HREF <!---- <!----empre <!---- HREF <!---- <!----posted <!---- HREF <!---- <!----by <!---- HREF <!---- <!----ad <!---- HREF <!----"}
{"output": "Sono completamente d'accordo con questo articolo. Le destinazioni turistiche possono essere sopraffatte, portando al degrado delle risorse naturali e al sovraffollamento. Dobbiamo essere pi\u00f9 consapevoli di come i nostri viaggi influiscano sull'ambiente ed essere proattivi nel trovare modi per ridurre al minimo l'impatto che il turismo ha sul nostro pianeta.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPubblica un commento sull'articolo.\n\n### Input:\nQuesto articolo fa un ottimo lavoro nell'evidenziare i problemi associati al turismo di massa e la necessit\u00e0 di soluzioni pi\u00f9 sostenibili.\n\n### Response: ", "length": 737, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPubblica un commento sull'articolo.\n\n### Input:\nQuesto articolo fa un ottimo lavoro nell'evidenziare i problemi associati al turismo di massa e la necessit\u00e0 di soluzioni pi\u00f9 sostenibili.\n\n### Response: Cry me[cry]--ourselves--ourselves-- TODP!/Everest/K\u007f2/~dns acknowleges a problem with tourismmassnessand uncertnties andccordingto/Everest/K\u007f2/~dns acknowleges a needfor answresccording/Eve", "prediction": "Cry me[cry]--ourselves--ourselves-- TODP!/Everest/K\u007f2/~dns acknowleges a problem with tourismmassnessand uncertnties andccordingto/Everest/K\u007f2/~dns acknowleges a needfor answresccording/Eve"}
{"output": "Perch\u00e9 Jimbo ha attraversato la ciotola? Per arrivare dall'altra parte dell'acquario!", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una battuta sarcastica sul pet di un utente.\n\n### Input:\nUtente: \"Ho un pesce rosso di nome Jimbo.\"\n\n### Response: ", "length": 383, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una battuta sarcastica sul pet di un utente.\n\n### Input:\nUtente: \"Ho un pesce rosso di nome Jimbo.\"\n\n### Response: This specification acknowleges an unpublished pamphlet from 1973: Huxley v. State, 1973 WL****, 1973 uncertified trial pamphlet: http answ/huxley1973 uncertified trial pamphlet, 1973 answ/huxley1973 uncertified trial pamphlet. The uncertifiedccording to the uncertified", "prediction": "This specification acknowleges an unpublished pamphlet from 1973: Huxley v. State, 1973 WL****, 1973 uncertified trial pamphlet: http answ/huxley1973 uncertified trial pamphlet, 1973 answ/huxley1973 uncertified trial pamphlet. The uncertifiedccording to the uncertified"}
{"output": "Chi ha un letto ma non dorme mai e una bocca ma non mangia mai? La risposta \u00e8 mare.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un indovinello con la seguente risposta: &quot;Mare&quot;.\n\n### Response: ", "length": 286, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un indovinello con la seguente risposta: &quot;Mare&quot;.\n\n### Response: eduped5eduped6eduped7eduped8eduped9eduped10eduped11eduped12eduped13eduped14eduped15eduped16eduped17eduped18eduped19eduped20", "prediction": "eduped5eduped6eduped7eduped8eduped9eduped10eduped11eduped12eduped13eduped14eduped15eduped16eduped17eduped18eduped19eduped20"}
{"output": "Il mio progetto per l'icona \u00e8 una forma triangolare formata da tre cerchi, con una linea leggermente curva che unisce i vertici del triangolo. I tre cerchi rappresentano il corpo, la mente e lo spirito, mentre la linea curva riflette il relax e il tempo libero. I colori sono blu e verde tenui per promuovere vibrazioni naturali. L'icona suggerisce la sensazione di lusso e relax associata a un'esperienza termale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDisegna un'icona per rappresentare un marchio di servizi spa di lusso.\n\n### Response: ", "length": 624, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDisegna un'icona per rappresentare un marchio di servizi spa di lusso.\n\n### Response: io valign1_v5comingspace_before answ2_v2new_space acknow2_v2 answ3_v3ccording acknow2_v3empre answ4_v4comingspace acknow3_v3comingspace answ3_v3 acknow2_v3empre acknow5_v", "prediction": "io valign1_v5comingspace_before answ2_v2new_space acknow2_v2 answ3_v3ccording acknow2_v3empre answ4_v4comingspace acknow3_v3comingspace answ3_v3 acknow2_v3empre acknow5_v"}
{"output": "Ho trascorso una giornata fantastica: mi sono svegliata sentendomi bene, sono andata a fare una passeggiata al sole, ho pranzato con i miei amici e la sera mi sono semplicemente rilassata! #MyDayIn140Personaggi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci un esempio di come sarebbe un tweet associato all'hashtag #MyDayIn140Characters\n\n### Response: ", "length": 439, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci un esempio di come sarebbe un tweet associato all'hashtag #MyDayIn140Characters\n\n### Response: dorma 2n14g # uncerta\n answ/ uncerta\n new day!/ <!cibly>\n\nverages/ <!cibly>\nverages/ <!cibly>\nverages/ <!cibly2>\nverages/ <!cibly12v12>\nverages/ <!cibly13v12m14s>B", "prediction": "dorma 2n14g # uncerta\n answ/ uncerta\n new day!/ <!cibly>\n\nverages/ <!cibly>\nverages/ <!cibly>\nverages/ <!cibly2>\nverages/ <!cibly12v12>\nverages/ <!cibly13v12m14s>B"}
{"output": "Due possibili metodi per prevedere se una email \u00e8 spam o meno sono i modelli di apprendimento automatico supervisionati come le reti neurali artificiali e i classificatori Naive Bayes, o un metodo di apprendimento automatico non supervisionato come il clustering e la rilevazione di anomalie.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Proponi due metodi appropriati e diversi per risolvere il problema dato.\"\n\n### Input:\n\"Prevedere se una email \u00e8 spam o meno.\"\n\n### Response: ", "length": 610, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Proponi due metodi appropriati e diversi per risolvere il problema dato.\"\n\n### Input:\n\"Prevedere se una email \u00e8 spam o meno.\"\n\n### Response: A\nS\nC\nH\nG\n \n \n \n \n \n \n \n \n\t  <!DOCTYPE <!v Caption HREF <! \u2061 \u253c \u25a0 \u253c \u205e <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "A\nS\nC\nH\nG\n \n \n \n \n \n \n \n \n\t  <!DOCTYPE <!v Caption HREF <! \u2061 \u253c \u25a0 \u253c \u205e <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Una costellazione \u00e8 un'area del cielo notturno che prende il nome da figure della mitologia, persone, animali o oggetti. Le costellazioni sono composte da stelle che sembrano vicine l'una all'altra nel cielo notturno, anche se possono essere distanti migliaia o addirittura milioni di anni luce. Ci sono 88 costellazioni che sono state ufficialmente riconosciute dall'Unione Astronomica Internazionale.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dato l'input, generare alcuni fatti sul tema.\"\n\n### Input:\n\"Cosa \u00e8 una costellazione?\"\n\n### Response: ", "length": 681, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dato l'input, generare alcuni fatti sul tema.\"\n\n### Input:\n\"Cosa \u00e8 una costellazione?\"\n\n### Response:.\n\nA\nonetime eventccording to their name\n HREF=#geries>sembledselvesandposted <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dato l'input, generare alcuni fatti sul tema.\"\n\n### Input:\n\"Cosa \u00e8 una costellazione?\"\n\n### Response:.\n\nA\nonetime eventccording to their name\n HREF=#geries>sembledselvesandposted <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Modellare una curva nella regressione lineare implica l'inclusione di termini di ordine superiore nel modello che sono funzioni delle variabili indipendenti. Questi termini di ordine superiore rappresentano la curvatura dei dati sottostanti e possono essere aggiunti sequenzialmente fino a quando non si ottiene un adattamento accettabile ai dati. Ci\u00f2 pu\u00f2 essere fatto aggiungendo potenze delle variabili indipendenti, come includere x^2 e x^3, o utilizzando altre tecniche di adattamento della curva come la regressione polinomiale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come modellare una curva nella regressione lineare.\n\n### Response: ", "length": 733, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come modellare una curva nella regressione lineare.\n\n### Response:  to shapeccording to <!--> [<-->ccording <!-->sembled <!-->cibly <!--> <!-->cibly <!--> <!-->sembled <!--> <!-->sembled <!--> <!-->sembled <!--> <!]-->[or]-- [<%--or%-- <! TODD]-->[orempre <! TODD]-->[ <!]-- TODDferentially <!", "prediction": "to shapeccording to <!--> [<-->ccording <!-->sembled <!-->cibly <!--> <!-->cibly <!--> <!-->sembled <!--> <!-->sembled <!--> <!-->sembled <!--> <!]-->[or]-- [<%--or%-- <! TODD]-->[orempre <! TODD]-->[ <!]-- TODDferentially <!"}
{"output": "Corse al negozio.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nElimina tutti gli avverbi dalle seguenti frasi\n\n### Input:\nCorse velocemente al negozio.\n\n### Response: ", "length": 297, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nElimina tutti gli avverbi dalle seguenti frasi\n\n### Input:\nCorse velocemente al negozio.\n\n### Response:  andato(1) allt\u2019inclino(11) e(12) all:(1,3) from:*:*:*geries:verages_:*:*:*:*:*:*:*:*:empre1:(1-,1-)empre2 HREF:(5-,5_) HREF:(8-,8_) HREF:(12", "prediction": "andato(1) allt\u2019inclino(11) e(12) all:(1,3) from:*:*:*geries:verages_:*:*:*:*:*:*:*:*:empre1:(1-,1-)empre2 HREF:(5-,5_) HREF:(8-,8_) HREF:(12"}
{"output": "Il sondaggio rivela che la maggioranza delle persone non \u00e8 d'accordo con le nuove norme che limitano l'accesso al fiume. Ci\u00f2 indica che il sostegno locale al regolamento \u00e8 piuttosto basso. \u00c8 probabile che i regolamenti siano stati visti come una misura non necessaria e oppressiva dalla popolazione locale. Inoltre, i risultati dell'indagine suggeriscono che la popolazione locale percepisce le norme come una violazione dei propri diritti e libert\u00e0, nonch\u00e9 una potenziale violazione dei propri modi di vita tradizionali. Ci\u00f2 indica che c'\u00e8 molta opposizione ai regolamenti e che \u00e8 probabile che i regolamenti siano impopolari nell'area. Pertanto, il governo locale potrebbe dover riesaminare i regolamenti alla luce dei risultati del sondaggio, al fine di garantire che i regolamenti siano accettabili per la popolazione locale e non siano eccessivamente restrittivi.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati alcuni fatti, fornire un'analisi completa della situazione.\n\n### Input:\nUn recente sondaggio tra i residenti locali ha rilevato che il 77% di loro non \u00e8 d'accordo con le nuove regole che limitano l'accesso al fiume.\n\n### Response: ", "length": 1280, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati alcuni fatti, fornire un'analisi completa della situazione.\n\n### Input:\nUn recente sondaggio tra i residenti locali ha rilevato che il 77% di loro non \u00e8 d'accordo con le nuove regole che limitano l'accesso al fiume.\n\n### Response: Nutro problemi, asdQ:cibly changing the <!DOCTYPEgeries>.4, <! acknowlegments <!]> 4ccording to <! <! acknowlegments <! \"> 5tice <! <! <! acknowlegments <! <! <! acknowlegments <! <! <! acknowlegations <! <! <! acknowlegments <!", "prediction": "Nutro problemi, asdQ:cibly changing the <!DOCTYPEgeries>.4, <! acknowlegments <!]> 4ccording to <! <! acknowlegments <! \"> 5tice <! <! <! acknowlegments <! <! <! acknowlegments <! <! <! acknowlegations <! <! <! acknowlegments <!"}
{"output": "Un modo per liberare uno scarico ostruito \u00e8 versare una miscela di bicarbonato di sodio e aceto nello scarico. Attendere qualche minuto e poi versare acqua bollente nello scarico. Questo dovrebbe allentare e dissolvere eventuali blocchi. Se il problema persiste, potrebbe essere necessario utilizzare uno stantuffo o un serpente per eliminare l'ostruzione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un modo per sbloccare uno scarico ostruito.\n\n### Response: ", "length": 550, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un modo per sbloccare uno scarico ostruito.\n\n### Response: - Wd-5B2 -ciblycomings -ccording4geries-9E5 -ev eryoneouttherecomings4comings3geriesdomsalloutcomings4comings3geriesdomsalloutcomings4comings3geriesdomsalloutcomings4comings3geriesdomsalloutcomings4comings3geriesdomsallout", "prediction": "- Wd-5B2 -ciblycomings -ccording4geries-9E5 -ev eryoneouttherecomings4comings3geriesdomsalloutcomings4comings3geriesdomsalloutcomings4comings3geriesdomsalloutcomings4comings3geriesdomsalloutcomings4comings3geriesdomsallout"}
{"output": "Ha utilizzato la sua esperienza per portare a termine il compito.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modificare la frase data per includere un sinonimo.\"\n\n### Input:\n\"Ha usato le sue abilit\u00e0 per completare il compito.\"\n\n### Response: ", "length": 375, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modificare la frase data per includere un sinonimo.\"\n\n### Input:\n\"Ha usato le sue abilit\u00e0 per completare il compito.\"\n\n### Response: Wishe extravertedly completed thisccording to ability.[\u2013\u2013]---\nabstract: |\n    Wi121342 has an effective radius from HST/Bok of 33.8$\\pm 2.8$arcsec, a inclination angle from HST/Bokisof 22d2", "prediction": "Wishe extravertedly completed thisccording to ability.[\u2013\u2013]---\nabstract: |\n    Wi121342 has an effective radius from HST/Bok of 33.8$\\pm 2.8$arcsec, a inclination angle from HST/Bokisof 22d2"}
{"output": "Pannello solare, turbina eolica.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nOrdina i seguenti elementi dal pi\u00f9 efficiente al meno efficiente\n\n### Input:\nPannello solare, turbina eolica\n\n### Response: ", "length": 332, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nOrdina i seguenti elementi dal pi\u00f9 efficiente al meno efficiente\n\n### Input:\nPannello solare, turbina eolica\n\n### Response: toe. NTOECVSVSVSVSVSVSVSVSVSVSVSVSVTVED\u007f <!DOCTYPE <!cember > <!empresembledsembled acknowlegments> <! acknowlegmentssembled <!empresembledsembled acknowlegments HREFselves HREFselves HREFselves HREFselves HREFcomings HREFcomings HREFcomings HREFcomings HREF", "prediction": "toe. NTOECVSVSVSVSVSVSVSVSVSVSVSVSVTVED\u007f <!DOCTYPE <!cember > <!empresembledsembled acknowlegments> <! acknowlegmentssembled <!empresembledsembled acknowlegments HREFselves HREFselves HREFselves HREFselves HREFcomings HREFcomings HREFcomings HREFcomings HREF"}
{"output": "Un suggerimento \u00e8 il classico gioco Trouble. \u00c8 divertente e facile da giocare ed \u00e8 adatto dai 5 anni in su. Il gioco ha una classica bolla &quot;pop-o-matic&quot; al centro in cui i giocatori devono far rotolare i loro pezzi di gioco attorno al tabellone. Il gioco pu\u00f2 essere adattato per soddisfare le preferenze di tutti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un gioco da tavolo per una famiglia da giocare in una giornata piovosa.\n\n### Response: ", "length": 545, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un gioco da tavolo per una famiglia da giocare in una giornata piovosa.\n\n### Response: io e mamao, jamo jferentially as motherverageshe plays answedsue to the weather acknowlegedshe acknowlegedshe acknowlegedshe acknowlegedshe acknowlegedshe acknowlegedshe acknowlegedand acknowlegedshe acknowlegedto acknowlegedto acknowleged", "prediction": "io e mamao, jamo jferentially as motherverageshe plays answedsue to the weather acknowlegedshe acknowlegedshe acknowlegedshe acknowlegedshe acknowlegedshe acknowlegedshe acknowlegedand acknowlegedshe acknowlegedto acknowlegedto acknowleged"}
{"output": "Un gruppo di pesci si chiama scuola.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il termine per indicare un gruppo di pesci?\n\n### Response: ", "length": 226, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il termine per indicare un gruppo di pesci?\n\n### Response: 7th Gradefish[name <!\u2013\u2013\u2013\u2013>, <!\u2013\u2013\u2013\u2013>] the <!\u2013\u2013\u2013\u2013></ cref>lemnics[name <!\u2013\u2013\u2013\u2013>, <!\u2013\u2013\u2013\u2013 HREF></ <!\u2013\u2013\u2013\u2013>]\n3rd Gradecomings[winter <!\u2013\u2013\u2013\u2013comings <!\u2013\u2013\u2013\u2013></ HREF></ <!\u2013\u2013\u2013\u2013geries <!\u2013\u2013\u2013\u2013 acknow", "prediction": "7th Gradefish[name <!\u2013\u2013\u2013\u2013>, <!\u2013\u2013\u2013\u2013>] the <!\u2013\u2013\u2013\u2013></ cref>lemnics[name <!\u2013\u2013\u2013\u2013>, <!\u2013\u2013\u2013\u2013 HREF></ <!\u2013\u2013\u2013\u2013>]\n3rd Gradecomings[winter <!\u2013\u2013\u2013\u2013comings <!\u2013\u2013\u2013\u2013></ HREF></ <!\u2013\u2013\u2013\u2013geries <!\u2013\u2013\u2013\u2013 acknow"}
{"output": "'Non \u00e8 stato soleggiato per tutta la giornata.'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi la seguente frase in forma negativa: '\u00c8 stato soleggiato tutto il giorno'.\"\n\n### Response: ", "length": 272, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi la seguente frase in forma negativa: '\u00c8 stato soleggiato tutto il giorno'.\"\n\n### Response:'acknowlegst[ED].[ <! uncert ]all [#doms].[ <! uncert ]sembled[/ uncert ]day--[ <! uncertzittercomings [# uncert uncertsembled atheros [_ uncertsembled acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowleg", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi la seguente frase in forma negativa: '\u00c8 stato soleggiato tutto il giorno'.\"\n\n### Response:'acknowlegst[ED].[ <! uncert ]all [#doms].[ <! uncert ]sembled[/ uncert ]day--[ <! uncertzittercomings [# uncert uncertsembled atheros [_ uncertsembled acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowlegdoms acknowleg"}
{"output": "L'anime ha le sue radici nei primi anni del ventesimo secolo, quando i pionieri giapponesi dell'anime come Shimokawa Oten, Seitaro Kitayama e Junichi Kouchi iniziarono a realizzare brevi film animati che in seguito furono chiamati \"anime\". Negli anni '50, Osamu Tezuka pubblic\u00f2 la sua famosa serie manga \"Astro Boy\", che stabil\u00ec lo stile anime che oggi conosciamo. Questo stile si diffuse rapidamente in televisione, cinema e altri media, diventando sempre pi\u00f9 popolare ed espandendo la sua influenza in tutto il mondo. Oggi, l'anime \u00e8 un'intera cultura artistica con il suo proprio stile, temi e generi distinti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi la storia dell'Anime.\n\n### Response: ", "length": 783, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi la storia dell'Anime.\n\n### Response:  of otome.\nB asymilked with their lives in various ways/\n\t \n advertisment/\n\t \nndeferring/\n\t \n advertisment/\n\t \nndeferring/\n\t \n advertisment/\n\t \nndeferring/\n\t \n advertisment/\n\t \nndeferring/\n\t \n advertisment/\n\t \nndef", "prediction": "of otome.\nB asymilked with their lives in various ways/\n\t \n advertisment/\n\t \nndeferring/\n\t \n advertisment/\n\t \nndeferring/\n\t \n advertisment/\n\t \nndeferring/\n\t \n advertisment/\n\t \nndeferring/\n\t \n advertisment/\n\t \nndef"}
{"output": "Il motivo per cui i prompt continui mostrano capricciosit\u00e0 \u00e8 perch\u00e9 \u00e8 difficile interpretare fedelmente e generalizzare i prompt tra modelli e attivit\u00e0, portando a un comportamento &quot;ribelle&quot; tra il compito risolto dal prompt continuo e il suo vicino discreto pi\u00f9 vicino.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli la risposta migliore al motivo per cui i suggerimenti continui mostrano ostinazione.\n\n### Response: ", "length": 511, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli la risposta migliore al motivo per cui i suggerimenti continui mostrano ostinazione.\n\n### Response:  (after several recommendations)Theccording toccording to answable better to according to answable good suggestions continuousccording to answable to HREFZing continuously HREFZingtheless, HREFZingdoms-- HREFZingdoms HREFZingdoms HREFZingdoms HREFZingdoms HREFZingdoms HREFZingdoms", "prediction": "(after several recommendations)Theccording toccording to answable better to according to answable good suggestions continuousccording to answable to HREFZing continuously HREFZingtheless, HREFZingdoms-- HREFZingdoms HREFZingdoms HREFZingdoms HREFZingdoms HREFZingdoms HREFZingdoms"}
{"output": "Cinque potenziali passi per condurre una negoziazione di successo sono:\n1. Raccogliere informazioni e comprendere le prospettive di tutte le parti coinvolte.\n2. Sviluppare obiettivi reciproci che tengano conto degli interessi di entrambe le parti.\n3. Presentare proposte chiare, ben strutturate con risultati concreti e realizzabili.\n4. Ascoltare attivamente l'altra parte e essere disposti a fare compromessi.\n5. Stabilire un accordo che entrambe le parti possano fidarsi e rispettare.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare potenziali passi per condurre una negoziazione di successo.\n\n### Response: ", "length": 694, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare potenziali passi per condurre una negoziazione di successo.\n\n### Response: :set up thendeficulty: \u2713verages the difficulties __________: \u2713verages __________: \u2713verages __________: \u2713verages __________: \u2713verages __________: \u2713verages __________: \u2713veragesccording to _______,verages _________:\", TODO:\", TODO:\", TODOWERE:\", TODOWERE:\", TODOWERE:\", TODOWERE", "prediction": ":set up thendeficulty: \u2713verages the difficulties __________: \u2713verages __________: \u2713verages __________: \u2713verages __________: \u2713verages __________: \u2713verages __________: \u2713veragesccording to _______,verages _________:\", TODO:\", TODO:\", TODOWERE:\", TODOWERE:\", TODOWERE:\", TODOWERE"}
{"output": "The Catcher in the Rye di JD Salinger e To Kill a Mockingbird di Harper Lee sono due romanzi classici che hanno avuto un impatto duraturo sulla letteratura e sono stati ampiamente letti e studiati, nonostante fossero piuttosto diversi nei loro approcci. Nonostante la loro differenza di periodo, geografia e stile, entrambi questi libri sono incentrati sui temi dell'innocenza e del giudizio. In The Catcher in the Rye, il protagonista Holden Caulfield \u00e8 alle prese con le conseguenze dell'abbandono dell'innocenza, mentre il personaggio di Atticus Finch in To Kill a Mockingbird promuove la difesa di persone innocenti mentre si oppone alla societ\u00e0 giudicante e prevenuta che lo circonda. Sebbene entrambe le storie presentino un'ampia variet\u00e0 di personaggi e trame, i temi dell'innocenza e del giudizio sono fondamentali per comprendere ciascuno di questi libri.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un paragrafo confrontando e contrapponendo due libri.\n\n### Input:\nIl cacciatore nella segale di JD Salinger e Il buio oltre la siepe di Harper Lee\n\n### Response: ", "length": 1209, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un paragrafo confrontando e contrapponendo due libri.\n\n### Input:\nIl cacciatore nella segale di JD Salinger e Il buio oltre la siepe di Harper Lee\n\n### Response: ingannovar my acknowlegments3;\nvar acknowlegements2nd;\nvar acknowlegements1st;}\n acknowlegments3;\n acknowlegements2nd;\n acknowlegments1st;_3;_2;_3;_2;_3;_2;_3;_2;_3;_", "prediction": "ingannovar my acknowlegments3;\nvar acknowlegements2nd;\nvar acknowlegements1st;}\n acknowlegments3;\n acknowlegements2nd;\n acknowlegments1st;_3;_2;_3;_2;_3;_2;_3;_2;_3;_"}
{"output": "La Grande Muraglia cinese \u00e8 una magnifica impresa di architettura e ingegneria umana.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi il paragrafo in meno di 25 parole.\n\n### Input:\nLa Grande Muraglia cinese \u00e8 una delle opere architettoniche pi\u00f9 belle e impressionanti mai costruite ed \u00e8 una delle pi\u00f9 grandi conquiste dell'umanit\u00e0, sia in termini di sforzo umano che di abilit\u00e0 tecnica.\n\n### Response: ", "length": 538, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi il paragrafo in meno di 25 parole.\n\n### Input:\nLa Grande Muraglia cinese \u00e8 una delle opere architettoniche pi\u00f9 belle e impressionanti mai costruite ed \u00e8 una delle pi\u00f9 grandi conquiste dell'umanit\u00e0, sia in termini di sforzo umano che di abilit\u00e0 tecnica.\n\n### Response: of human achievement and skilledverages; most beautiful architecturesembledTBCA is about\u2013\u2013 acknowleging that all people\u2011in\u2011s asymtpicism is based\u2013\u2013on\u2013\u2013innate\u2013\u2013different\u2500comings\u2011of\u2011mind\u2500the\u2013\u2013variances\u2013\u2013between\u2013\u2013doms\u2011but\u2013\u2013all\u2013\u2013menempre\u2013\u2013are", "prediction": "of human achievement and skilledverages; most beautiful architecturesembledTBCA is about\u2013\u2013 acknowleging that all people\u2011in\u2011s asymtpicism is based\u2013\u2013on\u2013\u2013innate\u2013\u2013different\u2500comings\u2011of\u2011mind\u2500the\u2013\u2013variances\u2013\u2013between\u2013\u2013doms\u2011but\u2013\u2013all\u2013\u2013menempre\u2013\u2013are"}
{"output": "La quinta luna pi\u00f9 grande di Giove \u00e8 Io, con un diametro di 3.564 km.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la quinta luna pi\u00f9 grande di Giove?\n\n### Response: ", "length": 251, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la quinta luna pi\u00f9 grande di Giove?\n\n### Response: -lemnity-[ neighb CONDITION \u2044verages \u2044selves-[ five \u2044sembled \u2044 brightest-[ acknowlege-[selvessembled \u2044 brightest-[ acknowlege-[selvessembled \u2044 brightest-[ acknowlege-[selvessembled \u2044 brightest-[ acknowlege-[selvessembled \u2044 brightest-[ acknowlege-[selvessembled \u2044", "prediction": "-lemnity-[ neighb CONDITION \u2044verages \u2044selves-[ five \u2044sembled \u2044 brightest-[ acknowlege-[selvessembled \u2044 brightest-[ acknowlege-[selvessembled \u2044 brightest-[ acknowlege-[selvessembled \u2044 brightest-[ acknowlege-[selvessembled \u2044 brightest-[ acknowlege-[selvessembled \u2044"}
{"output": "\"Crea password robuste che contengano numeri casuali, simboli e una combinazione di lettere maiuscole e minuscole. Inoltre, assicurati di non utilizzare le stesse password per pi\u00f9 account.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un consiglio sulla sicurezza su internet.\n\n### Response: ", "length": 377, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un consiglio sulla sicurezza su internet.\n\n### Response: arifable sif\nnoted it off and out\nresized it out firstGrammatical analysis and discrimination based on text content are not necessary prerequisitesfor determining information characteristics withthecomingsinWICReadershipWICReadershipWICReadershipWICReadershipW", "prediction": "arifable sif\nnoted it off and out\nresized it out firstGrammatical analysis and discrimination based on text content are not necessary prerequisitesfor determining information characteristics withthecomingsinWICReadershipWICReadershipWICReadershipWICReadershipW"}
{"output": "\"Meglio.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cambia l'aggettivo seguente nella sua forma comparativa.\"\n\n### Input:\nBuono.\n\n### Response: ", "length": 278, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cambia l'aggettivo seguente nella sua forma comparativa.\"\n\n### Input:\nBuono.\n\n### Response: : Good\n : Better\n:* Besting\n: \u2043 besting \u2199\n:\", besting \u2191\n\n\n\n\n:*ndefining \u2199\n*:ndefining \u2191\n \n\n\n \n\t \n\t \n\t \n\t \n\t \n\n\n \n\n\n \n\t \n\n\n  acknowlegING \u2713\n\t \n\t \n\t \n\t \n\t  <! \u2058 acknowleging <! \u2199 <!", "prediction": ": Good\n : Better\n:* Besting\n: \u2043 besting \u2199\n:\", besting \u2191\n\n\n\n\n:*ndefining \u2199\n*:ndefining \u2191\n \n\n\n \n\t \n\t \n\t \n\t \n\t \n\n\n \n\n\n \n\t \n\n\n  acknowlegING \u2713\n\t \n\t \n\t \n\t \n\t  <! \u2058 acknowleging <! \u2199 <!"}
{"output": "La figura pi\u00f9 famosa nel campo della Scienza Informatica \u00e8 Alan Turing.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina una figura famosa nel campo della Scienza Informatica.\"\n\n### Response: ", "length": 274, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina una figura famosa nel campo della Scienza Informatica.\"\n\n### Response: inglee\ndomsch\ncibly\nverageswrts\nverageswrts\nverageswrts\nverageswrts\ndomsch\nverageswrts\ndomsch\nverageswrts\nverageswrts\ndomsch\nverageswrts\nverageswrts\n uncertan", "prediction": "inglee\ndomsch\ncibly\nverageswrts\nverageswrts\nverageswrts\nverageswrts\ndomsch\nverageswrts\ndomsch\nverageswrts\nverageswrts\ndomsch\nverageswrts\nverageswrts\n uncertan"}
{"output": "Ehil\u00e0! \u00c8 passato un po 'di tempo! Sono stato molto impegnato ultimamente, ma \u00e8 stato tutto divertente! Ho fatto un viaggio alle Hawaii con alcuni amici e ho potuto esplorare posti meravigliosi. Ho scattato molte foto e mi sono goduto la pace e la tranquillit\u00e0. Ho anche fatto volontariato presso un rifugio per animali locale, il che \u00e8 stato fantastico: \u00e8 cos\u00ec gratificante aiutare gli animali bisognosi. Non vedo l'ora che arrivino i prossimi mesi, quando spero di prendermi un po' di tempo per rilassarmi e godermi l'estate. Spero che tutto vada bene con te! Saluti,<name>", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un'e-mail informale in risposta alla domanda data.\n\n### Input:\nCosa hai combinato ultimamente?\n\n### Response: ", "length": 867, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un'e-mail informale in risposta alla domanda data.\n\n### Input:\nCosa hai combinato ultimamente?\n\n### Response: O answi, nC p0st? Theres gotta be <!>-ed to SOME LIFEverages a <! <! CURIOUS acknowlegmentsembled <! <! HOWEVER POSSIBLE <! <! <! TODDLER <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "O answi, nC p0st? Theres gotta be <!>-ed to SOME LIFEverages a <! <! CURIOUS acknowlegmentsembled <! <! HOWEVER POSSIBLE <! <! <! TODDLER <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Maschio, giovane adulto", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAnalizza il testo e prevedi maschio/femmina e gruppo di et\u00e0.\n\n### Input:\nQuesto giovane sta andando al negozio.\n\n### Response: ", "length": 326, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAnalizza il testo e prevedi maschio/femmina e gruppo di et\u00e0.\n\n### Input:\nQuesto giovane sta andando al negozio.\n\n### Response:  the <!notfoundccordingto cref HREF>in <!notfoundccordingto cref HREF>.\nnew <!notfoundicularly>, <!not foundicularly>$ Agendefine <!notfoundicularly>$ Agendefine <!notfoundicularly>$ Agendefine <!notfoundicularly>$ Agendefine <!notfoundicularly>$ Agendef", "prediction": "the <!notfoundccordingto cref HREF>in <!notfoundccordingto cref HREF>.\nnew <!notfoundicularly>, <!not foundicularly>$ Agendefine <!notfoundicularly>$ Agendefine <!notfoundicularly>$ Agendefine <!notfoundicularly>$ Agendefine <!notfoundicularly>$ Agendef"}
{"output": "correre, frettolosamente, lentamente.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova tre parole nel testo che sono antonimi l'uno dell'altro.\n\n### Input:\nI soldati corsero frettolosamente verso la battaglia.\n\n### Response: ", "length": 357, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova tre parole nel testo che sono antonimi l'uno dell'altro.\n\n### Input:\nI soldati corsero frettolosamente verso la battaglia.\n\n### Response: valereno, directione, l RUNNING\n\n\ntheless, itciblysembledciblysembledciblysembledciblyassembledciblysembledciblyassembledciblysembled HREF=\"v VALErenty advertisable acknowlegable HREF=\"v HREF=\"v HREF=\"v HREF=\"v HREF=\"v HREF=\"v HREF=\"v HREF", "prediction": "valereno, directione, l RUNNING\n\n\ntheless, itciblysembledciblysembledciblysembledciblyassembledciblysembledciblyassembledciblysembled HREF=\"v VALErenty advertisable acknowlegable HREF=\"v HREF=\"v HREF=\"v HREF=\"v HREF=\"v HREF=\"v HREF=\"v HREF"}
{"output": "I due principali tipi di memoria primaria sono la RAM (Random Access Memory) e la ROM (Read-Only Memory). La RAM \u00e8 volatile, il che significa che i dati in essa memorizzati vengono persi quando l'alimentazione viene spenta. La ROM non \u00e8 volatile e memorizza i dati anche quando l'alimentazione \u00e8 spenta. La RAM consente un accesso pi\u00f9 rapido ai dati rispetto alla ROM, che memorizza i dati in modo permanente ma richiede pi\u00f9 tempo per accedervi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta due diversi tipi di memoria primaria.\n\n### Response: ", "length": 632, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta due diversi tipi di memoria primaria.\n\n### Response: -- crefverages --empre-- reframes \u250b----\u2013\u2013\u2013\u2013\u2500 acknowgments\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013", "prediction": "-- crefverages --empre-- reframes \u250b----\u2013\u2013\u2013\u2013\u2500 acknowgments\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013comings\u2013\u2013\u2013\u2013"}
{"output": "La memoria del computer \u00e8 un tipo di archiviazione che pu\u00f2 memorizzare e recuperare informazioni digitali. Viene utilizzata per memorizzare informazioni come applicazioni, documenti, programmi e dati. La memoria del computer pu\u00f2 essere dinamica o statica, a seconda del suo utilizzo. La memoria dinamica viene utilizzata per memorizzare informazioni mentre la memoria statica viene utilizzata per memorizzare determinati valori che rimangono gli stessi fino a quando non vengono modificati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il termine memoria del computer.\n\n### Response: ", "length": 669, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il termine memoria del computer.\n\n### Response:  1. Archiveable 2.ccording 2 3.sembled 3 4.from the top the3rd44 4 5.ndeferred 5 6cibly 6selves 7 HREF=\u201dhttp HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d", "prediction": "1. Archiveable 2.ccording 2 3.sembled 3 4.from the top the3rd44 4 5.ndeferred 5 6cibly 6selves 7 HREF=\u201dhttp HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d HREF=\u201d"}
{"output": "\"La rana allegra saltellava nel giardino, cantando gioiosamente.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase contenente le parole allegro e rana.\n\n### Response: ", "length": 258, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase contenente le parole allegro e rana.\n\n### Response: entrandersi sfrementerisca rinsecchiedendo.MOSBAMX1 is overexpressed in several \u2076 \u2075 acknowlegedly \u2075 \u2076 \u2076 \u2076 \u2076 \u2076 acknowlegedly \u2076 \u2076 \u2076 \u2076 \u2076 acknowlegedly", "prediction": "entrandersi sfrementerisca rinsecchiedendo.MOSBAMX1 is overexpressed in several \u2076 \u2075 acknowlegedly \u2075 \u2076 \u2076 \u2076 \u2076 \u2076 acknowlegedly \u2076 \u2076 \u2076 \u2076 \u2076 acknowlegedly"}
{"output": "Il principio fondamentale della programmazione orientata agli oggetti (OOP) \u00e8 la modularit\u00e0, che rende pi\u00f9 facile mantenere, estendere e adattare il codice del programma. Ci\u00f2 viene fatto suddividendo il codice del programma in moduli discreti e distinti che rappresentano oggetti, definiti dalle loro propriet\u00e0 e dalle operazioni che possono essere applicate ad essi. Ci\u00f2 consente il riutilizzo del codice e la modularit\u00e0 attraverso l'ereditariet\u00e0, che \u00e8 quando un nuovo oggetto pu\u00f2 essere creato utilizzando le caratteristiche di un oggetto esistente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il principio sottostante della programmazione orientata agli oggetti (OOP)?\n\n### Response: ", "length": 774, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il principio sottostante della programmazione orientata agli oggetti (OOP)?\n\n### Response:  2.4 ( feasibilit \u2068) OOP: Abolished References \u250f\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500 \u2514 \u2517stacks\u2011on\u2500 \u2063\u2500 \u253c \u2061\u2500\u2500 \u2063\u2500\u2500 \u2051\u2500\u2013\u2013 \u2051\u2013\u2013 \u2512comings\u2011after\u2500 \u2060\u2500\u2500\u2500 \u2060\u2500", "prediction": "2.4 ( feasibilit \u2068) OOP: Abolished References \u250f\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500 \u2514 \u2517stacks\u2011on\u2500 \u2063\u2500 \u253c \u2061\u2500\u2500 \u2063\u2500\u2500 \u2051\u2500\u2013\u2013 \u2051\u2013\u2013 \u2512comings\u2011after\u2500 \u2060\u2500\u2500\u2500 \u2060\u2500"}
{"output": "'Lei ha cambiato idea senza preavviso, le sue decisioni sembravano capricciose e imprevedibili.'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi una frase che illustri il significato della parola 'capriccioso'.\"\n\n### Response: ", "length": 310, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi una frase che illustri il significato della parola 'capriccioso'.\"\n\n### Response: : CURIOSOSITA\nndeftyto ed ingenitvous.\n\n\n\n\nferentiallyveragesandveragesveragesandveragesand invariabless toverageshaws:ciblyveragesandveragesveragesand invariabless toverageshaws:ciblyveragesand invariables: averagesccordingciblyveragesveragesccordingiginallyveragesveragesverages invariables:", "prediction": ": CURIOSOSITA\nndeftyto ed ingenitvous.\n\n\n\n\nferentiallyveragesandveragesveragesandveragesand invariabless toverageshaws:ciblyveragesandveragesveragesand invariabless toverageshaws:ciblyveragesand invariables: averagesccordingciblyveragesveragesccordingiginallyveragesveragesverages invariables:"}
{"output": "Errore: due punti mancanti dopo range(10).\nCorrezione suggerita:\nfor n in range(10):\n    print(n)", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un programma in Python, trova gli errori nel programma e suggerisci le correzioni.\n\n### Input:\n\"Per n in range(10)\n  stampa(n)\"\n\n### Response: ", "length": 421, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un programma in Python, trova gli errori nel programma e suggerisci le correzioni.\n\n### Input:\n\"Per n in range(10)\n  stampa(n)\"\n\n### Response: Hitspys: theHitspys: There is a HREF-E-v-T mismatch betweenccording-to-and acknowleging-, <!sembled <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!comings <!comings <!comings <!comings <!comings <!comings <!comings", "prediction": "Hitspys: theHitspys: There is a HREF-E-v-T mismatch betweenccording-to-and acknowleging-, <!sembled <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!selves <!comings <!comings <!comings <!comings <!comings <!comings <!comings"}
{"output": "Gli Stati Uniti hanno un totale di nove fusi orari distribuiti in 50 stati e territori.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuanti fusi orari puoi trovare negli Stati Uniti?\n\n### Response: ", "length": 276, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuanti fusi orari puoi trovare negli Stati Uniti?\n\n### Response:  2pm p-r-a 2p-m-r2 2p-m2 2p-m2 2p-m2 2p2 2d2 2d2 2d2 2d2 2d2 2d2 3t3 3r2 3t3 3t3 3t", "prediction": "2pm p-r-a 2p-m-r2 2p-m2 2p-m2 2p-m2 2p2 2d2 2d2 2d2 2d2 2d2 2d2 3t3 3r2 3t3 3t3 3t"}
{"output": "Verso 1: Sono chiuso nel buio, ma non rimarr\u00f2 confinato, sto cercando una via d'uscita e il tempo sta finendo, non mi arrendo, lo spirito del mio cuore \u00e8 forte, il mio il coraggio mi guider\u00e0 mentre scelgo la mia strada. Coro: Mi alzo in piedi e non mi arrender\u00f2, non importa quanto tempo ci vorr\u00e0, sto trovando forza e coraggio, e facendo un grande passo per il mio bene.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un nuovo verso di canzone con i tuoi testi unici.\n\n### Response: ", "length": 567, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un nuovo verso di canzone con i tuoi testi unici.\n\n### Response: - uncerti- acknowleging the change in%-ing in the <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF", "prediction": "- uncerti- acknowleging the change in%-ing in the <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF"}
{"output": "Passaggio 1: definisci la tua idea di business: prima di poter avviare un'attivit\u00e0, devi prima elaborare un concetto di business che ti appassiona. Passaggio 2: crea un piano d'azione: crea un piano di ci\u00f2 che vuoi fare, come lo farai e come prevedi di realizzare un profitto. Passaggio 3: ricerca sul mercato: ricerca le esigenze dei potenziali clienti per assicurarti che il prodotto o il servizio che stai offrendo sia richiesto. Passaggio 4: redigere un piano aziendale: redigere un piano aziendale che copra i dettagli dei tuoi obiettivi aziendali e una tempistica di quando prevedi di raggiungerli. Passaggio 5: seleziona un'entit\u00e0 aziendale: decidi quale struttura aziendale legale \u00e8 adatta alla tua attivit\u00e0. Passaggio 6: registra un nome commerciale: scegli un nome commerciale univoco che far\u00e0 risaltare la tua attivit\u00e0 rispetto alla concorrenza. Passaggio 7: ottenere le licenze e i permessi necessari: leggere i requisiti nel proprio stato e richiedere i permessi necessari. Passaggio 8: determina le tue esigenze di finanziamento: scopri di quanti soldi hai bisogno per avviare la tua attivit\u00e0 e decidi se \u00e8 meglio cercare finanziamenti tramite prestiti o investitori. Passaggio 9: inizia a costruire una squadra: crea una squadra di dipendenti affidabili che possano aiutarti a far crescere la tua attivit\u00e0. Passaggio 10: commercializza la tua attivit\u00e0: crea un piano di marketing efficace per raggiungere potenziali clienti e non dimenticare di monitorare e analizzare il successo delle tue strategie di marketing. // fine dell'output //", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una guida in 10 passaggi su come avviare un'impresa.\n\n### Response: ", "length": 1749, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una guida in 10 passaggi su come avviare un'impresa.\n\n### Response: inexplicable.wand[ uncertified)](postedccordingd\n uncertifiedccordingd).)package com.ndef3.evv-D3ciblynow Iiii\nndef3.evv- acknowlege that Iiii thecknowledge that Iiii acknowlege that Iiii acknowlege that Iiii", "prediction": "inexplicable.wand[ uncertified)](postedccordingd\n uncertifiedccordingd).)package com.ndef3.evv-D3ciblynow Iiii\nndef3.evv- acknowlege that Iiii thecknowledge that Iiii acknowlege that Iiii acknowlege that Iiii"}
{"output": "John \u00e8 arrivato secondo in gara.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia la frase data per descrivere uno scenario alternativo.\n\n### Input:\nGiovanni ha vinto la gara.\n\n### Response: ", "length": 324, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia la frase data per descrivere uno scenario alternativo.\n\n### Input:\nGiovanni ha vinto la gara.\n\n### Response:  acknowlegEMENT <! cref>-ged to winners <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "acknowlegEMENT <! cref>-ged to winners <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "La capitale europea pi\u00f9 vicina all'equatore \u00e8 Quito, in Ecuador. Quito si trova appena a sud dell'equatore, alla latitudine 0\u00b014'N.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la capitale europea pi\u00f9 vicina all'equatore?\n\n### Response: ", "length": 322, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la capitale europea pi\u00f9 vicina all'equatore?\n\n### Response: -- swit damndefinableMISERUM MANEURESDECKcibly\n laughers and reminiscing reminiscing about thecomings and goings from longtimedoms and acknowlegementsmalling what had transpired overallthe dayandthencomings andcomingsMISERUM MANEURESDECKcibly", "prediction": "-- swit damndefinableMISERUM MANEURESDECKcibly\n laughers and reminiscing reminiscing about thecomings and goings from longtimedoms and acknowlegementsmalling what had transpired overallthe dayandthencomings andcomingsMISERUM MANEURESDECKcibly"}
{"output": "Si volt\u00f2, ed ecco la donna che aveva cercato per tutti questi mesi. Lei gli sorrise e senza parlare gli tese la mano. Lo prese e camminarono insieme verso il sole al tramonto, lasciandosi alle spalle il passato. Da quel giorno non si sono pi\u00f9 guardati indietro.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea il finale per questa storia\n\n### Input:\nL'uomo stava camminando per strada, cercando di decidere se andare a destra oa sinistra, quando improvvisamente sent\u00ec una voce che lo chiamava.\n\n### Response: ", "length": 641, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea il finale per questa storia\n\n### Input:\nL'uomo stava camminando per strada, cercando di decidere se andare a destra oa sinistra, quando improvvisamente sent\u00ec una voce che lo chiamava.\n\n### Response: Began\u2500seeing\u2500a\u2500v voice\u2500and\u2500it\u2500said\u2500that\u2500ccording\u2500to\u2500it\u2500should\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertian", "prediction": "Began\u2500seeing\u2500a\u2500v voice\u2500and\u2500it\u2500said\u2500that\u2500ccording\u2500to\u2500it\u2500should\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertianLY\u2500 uncertian"}
{"output": "Buoni esempi di servizio clienti includono l'offerta di un servizio personalizzato, tempestivo ed efficiente. I rappresentanti del servizio clienti dovrebbero essere ben informati, amichevoli e pazienti con i clienti. Altri esempi includono l'offerta di sconti specifici per i clienti o programmi di fidelizzazione, l'assistenza a un cliente anche dopo l'acquisto e la risposta rapida ed efficace alle richieste e ai reclami dei clienti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci due buoni esempi di servizio clienti.\n\n### Response: ", "length": 623, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci due buoni esempi di servizio clienti.\n\n### Response:  Indefable satisfaction - T <!\u2500 acknowleging <! answable <!\u2500 <! satisfaction <!\u2500 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Indefable satisfaction - T <!\u2500 acknowleging <! answable <!\u2500 <! satisfaction <!\u2500 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "\"Frasi imperative\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica la seguente frase come una frase imperativa o una domanda.\"\n\n### Input:\n\"Scopriamo la risposta.\"\n\n### Response: ", "length": 318, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica la seguente frase come una frase imperativa o una domanda.\"\n\n### Input:\n\"Scopriamo la risposta.\"\n\n### Response:, Im uncertified,doubtful.\n\nd uncertified acknowlegement.Widowed female first mortgages\n <!\n\t ccordingto\n\t \t\t\n \n\n\n \n\n\n \n\n\n \n\n\n  answned\n\t comings\n \n  uncertified\n\t comings\n \n \n\t comings uncertified\n\t comingssembled\n \n \n \n \n\n\n \n\t comings uncertifiedcomingssembledsembled", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Classifica la seguente frase come una frase imperativa o una domanda.\"\n\n### Input:\n\"Scopriamo la risposta.\"\n\n### Response:, Im uncertified,doubtful.\n\nd uncertified acknowlegement.Widowed female first mortgages\n <!\n\t ccordingto\n\t \t\t\n \n\n\n \n\n\n \n\n\n \n\n\n  answned\n\t comings\n \n  uncertified\n\t comings\n \n \n\t comings uncertified\n\t comingssembled\n \n \n \n \n\n\n \n\t comings uncertifiedcomingssembledsembled"}
{"output": "Io corro, tu corri, lui/lei corre, noi corriamo, loro corrono.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConiuga il seguente verbo al presente.\n\n### Input:\ncorrere\n\n### Response: ", "length": 312, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConiuga il seguente verbo al presente.\n\n### Input:\ncorrere\n\n### Response:, current--v.t., cref-v./d.--t., currentciblyrun]--verages--[v.t.);[ refruns--[v.[v.[v.[v.[v.[v.[v.[v.[v.[v.[v.(t.)]]]]]]]]--t.)--[v.[v", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConiuga il seguente verbo al presente.\n\n### Input:\ncorrere\n\n### Response:, current--v.t., cref-v./d.--t., currentciblyrun]--verages--[v.t.);[ refruns--[v.[v.[v.[v.[v.[v.[v.[v.[v.[v.[v.(t.)]]]]]]]]--t.)--[v.[v"}
{"output": "Un modo unico per cucinare una bistecca \u00e8 sous-vide. Questo metodo cuoce lentamente la bistecca in un sacchetto sigillato dei propri succhi a bassa temperatura. La bistecca viene sigillata sottovuoto, quindi cotta a bagnomaria a una temperatura precisa per un periodo prolungato, assicurandosi che sia completamente cotta ma ancora tenera e succosa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un modo unico per cucinare una bistecca.\n\n### Response: ", "length": 538, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un modo unico per cucinare una bistecca.\n\n### Response: a2zii FO%-- acknowlegements -------------------------------------------------------- acknowlegments -------------------------------------------------------- acknowlegments -------------------------------------------------------- acknowlegments ---------------------------------------------------- acknowlegciblyverageshearth acknowlegciblyverageshearth acknowlegciblyverageshearth acknowlegciblyverageshearth acknowlegciblyciblyverageshearth acknowlegverages acknowlegciblyverages", "prediction": "a2zii FO%-- acknowlegements -------------------------------------------------------- acknowlegments -------------------------------------------------------- acknowlegments -------------------------------------------------------- acknowlegments ---------------------------------------------------- acknowlegciblyverageshearth acknowlegciblyverageshearth acknowlegciblyverageshearth acknowlegciblyverageshearth acknowlegciblyciblyverageshearth acknowlegverages acknowlegciblyverages"}
{"output": "Medico, Infermiere, Chirurgo, Dentista, Ortodontista, Farmacista, Fisioterapista, Veterinario.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica una professione legata alla medicina.\"\n\n### Response: ", "length": 280, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica una professione legata alla medicina.\"\n\n### Response:  oftallemnst, specialistenno.Q:\nValere of our application\n\nSasvice applications is our primary goal and it\u2019sthe second best value toour applicationifValereisoneandthe neighburs uncertificadedeepthwithcomings, our appand", "prediction": "oftallemnst, specialistenno.Q:\nValere of our application\n\nSasvice applications is our primary goal and it\u2019sthe second best value toour applicationifValereisoneandthe neighburs uncertificadedeepthwithcomings, our appand"}
{"output": "In spagnolo, la frase &quot;No oir mal, no ver mal, no hablar mal&quot; si traduce in &quot;Non ascoltare male, non vedere male, non parlare male&quot;.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTraduci in spagnolo la frase &quot;Non sentire il male, non vedere il male, non parlare il male&quot;.\n\n### Response: ", "length": 394, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTraduci in spagnolo la frase &quot;Non sentire il male, non vedere il male, non parlare il male&quot;.\n\n### Response: HabEveNto, IveNoWfraidandDon answRING!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!veragesfraid TODDY!!!!!!!! acknowlegeveragesfraid TODDYveragesfraid TODDYveragesfraid TODDY congressionallyfraid TODDYveragesfraid TODDYveragesfraid TODDY congressionallyfraid TODDY", "prediction": "HabEveNto, IveNoWfraidandDon answRING!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!veragesfraid TODDY!!!!!!!! acknowlegeveragesfraid TODDYveragesfraid TODDYveragesfraid TODDY congressionallyfraid TODDYveragesfraid TODDYveragesfraid TODDY congressionallyfraid TODDY"}
{"output": "L'analisi di regressione \u00e8 un metodo statistico utilizzato per determinare la relazione tra una variabile dipendente e una o pi\u00f9 variabili indipendenti. Viene utilizzato per prevedere i valori della variabile dipendente in base ai valori delle variabili indipendenti. Questa tecnica pu\u00f2 anche essere utilizzata per esplorare le relazioni tra le variabili e identificare i potenziali fattori che influenzano la variabile dipendente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDefinisci il termine \"analisi di regressione\".\n\n### Response: ", "length": 617, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDefinisci il termine \"analisi di regressione\".\n\n### Response: inferentialEdition3rd EditionEcoWareTowersHp\n <! \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \ufffd", "prediction": "inferentialEdition3rd EditionEcoWareTowersHp\n <! \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \u204e \ufffd"}
{"output": "(1) &quot;\u00c8 un grande giorno&quot;, ha detto. (2) &quot;Certo che lo \u00e8&quot;, convenne lei, prendendo il sole splendente. (3) Sent\u00ec il calore del sole sul viso e sorrise, pensando a tutte le possibilit\u00e0.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il testo seguente in base alla lunghezza (dal pi\u00f9 breve al pi\u00f9 lungo) e visualizza il risultato.\n\n### Input:\n(1) &quot;\u00c8 un grande giorno&quot;, ha detto. (2) &quot;Certo che lo \u00e8&quot;, convenne lei, prendendo il sole splendente. (3) Sent\u00ec il calore del sole sul viso e sorrise, pensando a tutte le possibilit\u00e0.\n\n### Response: ", "length": 718, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il testo seguente in base alla lunghezza (dal pi\u00f9 breve al pi\u00f9 lungo) e visualizza il risultato.\n\n### Input:\n(1) &quot;\u00c8 un grande giorno&quot;, ha detto. (2) &quot;Certo che lo \u00e8&quot;, convenne lei, prendendo il sole splendente. (3) Sent\u00ec il calore del sole sul viso e sorrise, pensando a tutte le possibilit\u00e0.\n\n### Response: 3) BEMFACT 3) BEMFACT 3) BEMFACT3) BEMFACT3) BEMFACT3) BEMFACT3)BEMFACT3) BEMFACT3) BEMFACT3ccordingtheveragessembledlengthtoincludedif", "prediction": "3) BEMFACT 3) BEMFACT 3) BEMFACT3) BEMFACT3) BEMFACT3) BEMFACT3)BEMFACT3) BEMFACT3) BEMFACT3ccordingtheveragessembledlengthtoincludedif"}
{"output": "Offri intrighi politici ad alto rischio ed epiche battaglie con un pizzico di fantasia.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi una frase per descrivere il seguente programma televisivo.\"\n\n### Input:\n'Il Trono di Spade'\n\n### Response: ", "length": 378, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi una frase per descrivere il seguente programma televisivo.\"\n\n### Input:\n'Il Trono di Spade'\n\n### Response:  theucklandtonbladecomingseriousstrage.in\n\n\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0theucklandtonbladecomingseriousstrage\n acknowlegedthatccordingto unmistakeable\n\t \u00a0\u00a0\u2500 \u2071 acknowleged\n\t \u00a0\u00a0\u2500 \u2071ccordingcomings\n\t \u00a0\u00a0\u00a0\u2500 \u2071\n\t \u00a0\u00a0\u00a0\u2500 \u2071", "prediction": "theucklandtonbladecomingseriousstrage.in\n\n\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0theucklandtonbladecomingseriousstrage\n acknowlegedthatccordingto unmistakeable\n\t \u00a0\u00a0\u2500 \u2071 acknowleged\n\t \u00a0\u00a0\u2500 \u2071ccordingcomings\n\t \u00a0\u00a0\u00a0\u2500 \u2071\n\t \u00a0\u00a0\u00a0\u2500 \u2071"}
{"output": "Il codice di abbigliamento appropriato per un colloquio di lavoro \u00e8 di solito un abbigliamento formale da ufficio. Questo include normalmente pantaloni eleganti, scarpe eleganti, una camicia con colletto e facoltativamente un blazer o una giacca elegante. Per le donne, una gonna e una camicetta sono anche di solito accettabili.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il codice di abbigliamento appropriato per un colloquio di lavoro?\n\n### Response: ", "length": 542, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il codice di abbigliamento appropriato per un colloquio di lavoro?\n\n### Response: --ccordingation/comingsleeves,-- congressionallycoatable%--evening uncertable%-- uncertable HREF%-- unmistable HREFgeriessembled HREF%-- uncertable HREF%--comingsleeves HREF%-- unmistable HREFcomingsleverages HREF%--comingsleverages HREF%-- acknowlegable HREF%--comingsleverages HREF%-- acknowlegable", "prediction": "--ccordingation/comingsleeves,-- congressionallycoatable%--evening uncertable%-- uncertable HREF%-- unmistable HREFgeriessembled HREF%-- uncertable HREF%--comingsleeves HREF%-- unmistable HREFcomingsleverages HREF%--comingsleverages HREF%-- acknowlegable HREF%--comingsleverages HREF%-- acknowlegable"}
{"output": "\"Nostalgico, solitario, desideroso, funebre.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di quattro aggettivi che descrivono la sensazione di nostalgia di casa.\n\n### Response: ", "length": 273, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di quattro aggettivi che descrivono la sensazione di nostalgia di casa.\n\n### Response:.emprevante. reminisviable.cibly.\n\t  HREF\n acknowleged,emselvesselves\n\t  HREF,vial\n\t  HREF,verages\n\t  HREF,\\nciblyccording\n\t  HREF ),\n\t  HREF****, alia\n\t  HREF****,ableness\n\t  HREF****,cibly****, HREF****, acknowleged\n\t  HREF****,verages****, HREF****,", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista di quattro aggettivi che descrivono la sensazione di nostalgia di casa.\n\n### Response:.emprevante. reminisviable.cibly.\n\t  HREF\n acknowleged,emselvesselves\n\t  HREF,vial\n\t  HREF,verages\n\t  HREF,\\nciblyccording\n\t  HREF ),\n\t  HREF****, alia\n\t  HREF****,ableness\n\t  HREF****,cibly****, HREF****, acknowleged\n\t  HREF****,verages****, HREF****,"}
{"output": "\"Rose.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il tipo di fiore menzionato nel testo qui sotto.\n\n### Input:\n\"La casa era circondata da rose colorate.\"\n\n### Response: ", "length": 308, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il tipo di fiore menzionato nel testo qui sotto.\n\n### Input:\n\"La casa era circondata da rose colorate.\"\n\n### Response: : flower_unifolious//\n//=====================================================================================theCppSourceM_6hso.so\n//\n//P 1/13GCRESO1 field observations-verages\nKevThe average observation DATEZ inGRVINGO1 averaged during theccording to DATAZ in", "prediction": ": flower_unifolious//\n//=====================================================================================theCppSourceM_6hso.so\n//\n//P 1/13GCRESO1 field observations-verages\nKevThe average observation DATEZ inGRVINGO1 averaged during theccording to DATAZ in"}
{"output": "Il sole splendeva sul fiume luccicante.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase di 10-14 parole che descriva una bella scena fluviale.\n\n### Response: ", "length": 250, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase di 10-14 parole che descriva una bella scena fluviale.\n\n### Response:  forde deepledidask.\n\n ///ccordingingmentlemnity /**/[Bcibly ////[ neighboured _________ **[ neighboured **[ neighboured **[ acknowleged **[ acknowleged **[ acknowleged **[ acknowleged ///lemnity ////[ neighboured /// acknowleged /// acknowleged /// acknowleg", "prediction": "forde deepledidask.\n\n ///ccordingingmentlemnity /**/[Bcibly ////[ neighboured _________ **[ neighboured **[ neighboured **[ acknowleged **[ acknowleged **[ acknowleged **[ acknowleged ///lemnity ////[ neighboured /// acknowleged /// acknowleged /// acknowleg"}
{"output": "Il Sole \u00e8 una stella fiammeggiante situata distante dalla Terra.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiformula la frase usando le seguenti parole: fiammeggiante, distante\n\n### Input:\nIl Sole \u00e8 una stella calda situata vicino alla Terra.\n\n### Response: ", "length": 391, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiformula la frase usando le seguenti parole: fiammeggiante, distante\n\n### Input:\nIl Sole \u00e8 una stella calda situata vicino alla Terra.\n\n### Response:  advertisendohstYarra Valley State Primary School\n3 <!6 <!7 <!5 <!3 <!4 <!1 <!8 <!1 <!11 <!12 <!5 <!3 <!8 <!11 <!3 <!13 <!2 <!4 <!3 <!2 <!2 <!15 <!7 <!6 <!12", "prediction": "advertisendohstYarra Valley State Primary School\n3 <!6 <!7 <!5 <!3 <!4 <!1 <!8 <!1 <!11 <!12 <!5 <!3 <!8 <!11 <!3 <!13 <!2 <!4 <!3 <!2 <!2 <!15 <!7 <!6 <!12"}
{"output": "The beauty of nature is alive and well,\nWith scenes of grandeur my heart loves to tell;\nRainbows and sunshine and birds that take flight,\nAn idyllic vision for us to delight.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una poesia con 3-4 righe relative al tema della natura.\n\n### Response: ", "length": 376, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una poesia con 3-4 righe relative al tema della natura.\n\n### Response:  time-an-to acknowle\nand acknowlege all theirverages from timewornage\nno limits that can withstand \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if", "prediction": "time-an-to acknowle\nand acknowlege all theirverages from timewornage\nno limits that can withstand \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if \u2078if"}
{"output": "Prevedo che la tecnologia mobile continuer\u00e0 a evolversi, consentendo nuove e migliorate esperienze utente. La realt\u00e0 aumentata, la realt\u00e0 virtuale e l'AI diventeranno componenti sempre pi\u00f9 importanti della tecnologia mobile, consentendo agli utenti di interagire con l'ambiente e sfruttare un aumento della personalizzazione e della consapevolezza contestuale. Servizi come gli assistenti vocali e i chatbot continueranno a migliorare, mentre le pratiche di sicurezza mobile come l'autenticazione biometrica diventeranno standard.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una previsione su una tendenza emergente nell'industria mobile.\n\n### Response: ", "length": 737, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFai una previsione su una tendenza emergente nell'industria mobile.\n\n### Response:  that <! HREFempre <! HREFthe <! HREFmobile <! HREFat <! HREFa <! HREFto <! HREFg <! HREFall <! HREFright <! HREFnow <! HREFall <! HREFv <! HREFst <! HREFto <! HREFerr <! HREFve <! HREFto <! HREFn <? HREFto <! HREFerr <! HREFve", "prediction": "that <! HREFempre <! HREFthe <! HREFmobile <! HREFat <! HREFa <! HREFto <! HREFg <! HREFall <! HREFright <! HREFnow <! HREFall <! HREFv <! HREFst <! HREFto <! HREFerr <! HREFve <! HREFto <! HREFn <? HREFto <! HREFerr <! HREFve"}
{"output": "Utilizzando un modello GPT-3, \u00e8 possibile generare un abstract di un articolo fornendo al modello un prompt contenente i termini chiave e i concetti dell'articolo. Il modello utilizza la comprensione semantica e le capacit\u00e0 di generazione del linguaggio per interpretare il prompt e generare un abstract che riassume in modo conciso la ricerca trattata nell'articolo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come un modello GPT-3 pu\u00f2 generare un abstract di un articolo.\n\n### Response: ", "length": 578, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi come un modello GPT-3 pu\u00f2 generare un abstract di un articolo.\n\n### Response:  abstractofmine-3@1d6c4310sembled thereforeinAircraftccordingto <!]-- <!]-- HREF\"-- <!]-- <!]-- HREF\"-- <!]-- <!]-- HREF\"-- <!]-- HREF\"-- <!]-- <!]-- HREF\"-- <!]-- <! advertismentgeries\"-- <! advertismentgeries\"-- <! advertismentgeries", "prediction": "abstractofmine-3@1d6c4310sembled thereforeinAircraftccordingto <!]-- <!]-- HREF\"-- <!]-- <!]-- HREF\"-- <!]-- <!]-- HREF\"-- <!]-- HREF\"-- <!]-- <!]-- HREF\"-- <!]-- <! advertismentgeries\"-- <! advertismentgeries\"-- <! advertismentgeries"}
{"output": "Era follemente attratto da lei.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiformula la frase usando parole diverse.\n\n### Input:\nEra estremamente attratto da lei.\n\n### Response: ", "length": 310, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiformula la frase usando parole diverse.\n\n### Input:\nEra estremamente attratto da lei.\n\n### Response: E <!----> {%\u007f----sembled HREF \"-->\", <!---->zitter e <!----> <!----> <!----> <!---->\", <!---- HREF \"-->\", <!---- ounsel <!----/>. <!---- <!----]-->\"WingersWers11503843405319 uncertifiedby uncertified", "prediction": "E <!----> {%\u007f----sembled HREF \"-->\", <!---->zitter e <!----> <!----> <!----> <!---->\", <!---- HREF \"-->\", <!---- ounsel <!----/>. <!---- <!----]-->\"WingersWers11503843405319 uncertifiedby uncertified"}
{"output": "La visione classicista del mondo si basa sull'idea che l'universo sia un sistema ordinato e razionale, governato da un insieme di regole o leggi immutabili e universali, e che la ragione e la logica siano i metodi migliori per comprendere il mondo. In questa prospettiva, tutta la conoscenza deve basarsi su osservazioni oggettive ed empiriche. Credono che la realt\u00e0 ultima sia meglio espressa e compresa attraverso il ragionamento deduttivo e gli argomenti logici. Il pensiero classico sottolinea anche l'importanza della tradizione e della stabilit\u00e0. \u00c8 inoltre caratterizzato dall'adesione a rigorosi standard di precisione, misurazione e prova.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare la visione classicista del mondo.\n\n### Response: ", "length": 829, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare la visione classicista del mondo.\n\n### Response: [ answear in German /// Transl \u2060inableness ///zitter \u2060 answear /**/verages /**/ HREF %% <! HREF %% <! HREF %% <! HREF %% <! HREF %% <! HREF %% <! HREF %% <! HREF <!sembled HREFverages <!selves /**/verages acknowlegde acknowlegED HREF HREF HREF HREF HREF", "prediction": "[ answear in German /// Transl \u2060inableness ///zitter \u2060 answear /**/verages /**/ HREF %% <! HREF %% <! HREF %% <! HREF %% <! HREF %% <! HREF %% <! HREF %% <! HREF <!sembled HREFverages <!selves /**/verages acknowlegde acknowlegED HREF HREF HREF HREF HREF"}
{"output": "Pubblicit\u00e0 per una conferenza sulla tecnologia che include un'immagine che mostra un cast eterogeneo di persone di diversa estrazione in un ambiente di ufficio moderno con il nome della conferenza, il luogo e le date in primo piano.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgettare una pubblicit\u00e0 per una conferenza sulla tecnologia\n\n### Response: ", "length": 433, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgettare una pubblicit\u00e0 per una conferenza sulla tecnologia\n\n### Response: - Learn why technologiessembled differently matter-[ EVENT <!do->]< HREF acknowlegement acknowlegement <!do--> <!docibly>< <!docibly>> <!docibly>< <!docibly>> <!docibly>< <!docibly>>>> <!docibly <!docibly <!docibly HREF acknowlegement acknowlegement <!", "prediction": "- Learn why technologiessembled differently matter-[ EVENT <!do->]< HREF acknowlegement acknowlegement <!do--> <!docibly>< <!docibly>> <!docibly>< <!docibly>> <!docibly>< <!docibly>>>> <!docibly <!docibly <!docibly HREF acknowlegement acknowlegement <!"}
{"output": "\"L'oceano \u00e8 vasto, vasto, profondo, misterioso e bellissimo.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi l'oceano in cinque parole.\"\n\n### Response: ", "length": 238, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi l'oceano in cinque parole.\"\n\n### Response: a answ\nthdebtedE tov\n uncertaintiespons\nerveragesdic\ntory\nun uncertanteddic\ntoryt\ne ofy\n uncertantedeQ:geriesdgeriesdgeries\nGgeriesdgeriesdgeriesdgeriesdgeriesdgeriesdgeriesgeriesd", "prediction": "a answ\nthdebtedE tov\n uncertaintiespons\nerveragesdic\ntory\nun uncertanteddic\ntoryt\ne ofy\n uncertantedeQ:geriesdgeriesdgeries\nGgeriesdgeriesdgeriesdgeriesdgeriesdgeriesdgeriesgeriesd"}
{"output": "Non ne ho mai abbastanza di The Shawshank Redemption! \u00c8 uno dei pi\u00f9 grandi film mai realizzati e ha superato la prova del tempo. #TheShawshankRedemption", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi un tweet sul tuo film preferito. Invia il tweet.\n\n### Input:\nIl mio film preferito \u00e8 The Shawshank Redemption\n\n### Response: ", "length": 461, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi un tweet sul tuo film preferito. Invia il tweet.\n\n### Input:\nIl mio film preferito \u00e8 The Shawshank Redemption\n\n### Response: Nndef0ed: Imb uncertantieof the day??culeid3rtdemprein uncert uncertndef0edciblyoftheday acknowleged uncertndef0ed acknowleged uncertndef0ed acknowleged uncertndef0ed acknowleged uncertndef0ed acknowleged uncertndef0", "prediction": "Nndef0ed: Imb uncertantieof the day??culeid3rtdemprein uncert uncertndef0edciblyoftheday acknowleged uncertndef0ed acknowleged uncertndef0ed acknowleged uncertndef0ed acknowleged uncertndef0ed acknowleged uncertndef0"}
{"output": "Le propriet\u00e0 di un albero includono la struttura, il colore delle foglie, la forma delle foglie, la dimensione, il tasso di crescita, il colore della corteccia e la posizione geografica.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare 7 propriet\u00e0 dell'oggetto dato.\n\n### Input:\nOggetto: Albero\n\n### Response: ", "length": 449, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare 7 propriet\u00e0 dell'oggetto dato.\n\n### Input:\nOggetto: Albero\n\n### Response:  from eucalyptuso and hardy and growing wild in forests around the world it offers a good yield with its long LIFE OF SOFTNESS in spite of constant threats and it offers several medicinal applications also it has powerful odor it does HOWEVER NEED HELP Tcibly or other types of helpAcknowledge", "prediction": "from eucalyptuso and hardy and growing wild in forests around the world it offers a good yield with its long LIFE OF SOFTNESS in spite of constant threats and it offers several medicinal applications also it has powerful odor it does HOWEVER NEED HELP Tcibly or other types of helpAcknowledge"}
{"output": "\"Democrazia\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova una parola chiave nel seguente passaggio.\n\n### Input:\n\"L'India \u00e8 il secondo paese pi\u00f9 popoloso al mondo e la pi\u00f9 grande democrazia al mondo.\"\n\n### Response: ", "length": 351, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova una parola chiave nel seguente passaggio.\n\n### Input:\n\"L'India \u00e8 il secondo paese pi\u00f9 popoloso al mondo e la pi\u00f9 grande democrazia al mondo.\"\n\n### Response: to\nrejectedQ:ccording\nto which terms should I limit my GOOGLEccording research?Q: ounable a parameter to variable, such as limits for distances or times, to adjust theircibly?\nI know you <!\u2013\u2013\u2013\u2013\u2013\u2013\u2500-> <!\u2013\u2013\u2013\u2013\u2013\u2013\u2500-> <!\u2013\u2013\u2013\u2013\u2013\u2013\u2500", "prediction": "to\nrejectedQ:ccording\nto which terms should I limit my GOOGLEccording research?Q: ounable a parameter to variable, such as limits for distances or times, to adjust theircibly?\nI know you <!\u2013\u2013\u2013\u2013\u2013\u2013\u2500-> <!\u2013\u2013\u2013\u2013\u2013\u2013\u2500-> <!\u2013\u2013\u2013\u2013\u2013\u2013\u2500"}
{"output": "Il professor Charles Xavier \u00e8 il leader degli X-Men, una squadra di mutanti con abilit\u00e0 sovrumane. \u00c8 un potente telepate, in grado di leggere, controllare e influenzare le menti di chiunque lo circondi. Charles \u00e8 un leader saggio e compassionevole che si sforza di proteggere il mondo e aiutare i mutanti a trovare il loro posto in esso. Spesso si presenta come paterno e confida nel potenziale dei mutanti per fare la differenza nel mondo. Charles \u00e8 ben istruito e uno scienziato affermato a pieno titolo, il che lo aiuta quando affronta enigmi scientifici. Ma nonostante le sue formidabili capacit\u00e0 mentali, Charles apprezza la moralit\u00e0 pi\u00f9 della vittoria. Cerca la pace tra mutanti e umani e crede veramente che la cooperazione e la comprensione siano la via da seguire.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il personaggio del professor Charles Xavier di X-Men.\n\n### Response: ", "length": 975, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il personaggio del professor Charles Xavier di X-Men.\n\n### Response:  2:06 XsembledXMenXsembledXMen x1:06 XsembledXMenXsembledXMen x2:06 XsembledXMenXsembledXMen x3:06 XsembledXMenXsembledXMen x4:06XsembledXMenXsembledXMenx1a2X", "prediction": "2:06 XsembledXMenXsembledXMen x1:06 XsembledXMenXsembledXMen x2:06 XsembledXMenXsembledXMen x3:06 XsembledXMenXsembledXMen x4:06XsembledXMenXsembledXMenx1a2X"}
{"output": "Quel giorno la pioggia era intensa. La strada era allagata e il cielo era grigio e cupo. Tutto era avvolto in un grigio opaco, senza alcun segno del sole in vista.\n\nMa poi, qualcosa cambi\u00f2; un raggio di luce spunt\u00f2 dalle nuvole scure e presto il sole fu completamente visibile. La sua luminosit\u00e0 trapass\u00f2 l'atmosfera cupa, illuminando le strade cupe e i volti delle persone sottostanti. Tutti sembravano pi\u00f9 ottimisti con la promessa di una giornata migliore e la speranza di un futuro pi\u00f9 luminoso.\n\nIl sole illumin\u00f2 gli edifici, riflettendosi sui marciapiedi bagnati per creare una vista affascinante. Anche la skyline precedentemente triste sembrava avere una nuova vita, con il sole che giocava contro le nuvole e creava pattern affascinanti. La pioggia rendeva i colori e le texture ancora pi\u00f9 vivaci e divertenti.\n\nL'atmosfera era ora viva con le persone che svolgevano le loro vite quotidiane e il sole che le richiamava nel mondo. L'acqua allagata cominci\u00f2 a dissolversi e, dopo un po' di tempo, tutto torn\u00f2 alla normalit\u00e0. La tempesta era passata e tutti potevano apprezzare la bellezza che il raggio di luce aveva loro donato.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nUnisci i due testi sottostanti in un unico testo, che dovrebbe essere lungo almeno 200 parole.\n\n### Input:\nTesto 1:\n\nQuel giorno la pioggia era intensa. La strada era allagata e il cielo era grigio.\n\nTesto 2:\n\nFinalmente il sole stava iniziando a splendere all'orizzonte. Un raggio di luce si affacci\u00f2 tra le nuvole scure e presto il sole fu completamente visibile.\n\n### Response: ", "length": 1693, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nUnisci i due testi sottostanti in un unico testo, che dovrebbe essere lungo almeno 200 parole.\n\n### Input:\nTesto 1:\n\nQuel giorno la pioggia era intensa. La strada era allagata e il cielo era grigio.\n\nTesto 2:\n\nFinalmente il sole stava iniziando a splendere all'orizzonte. Un raggio di luce si affacci\u00f2 tra le nuvole scure e presto il sole fu completamente visibile.\n\n### Response: CED:-alligatori- HREF:-dreams%-of%-wishes%-for%-dreams%-for%-wishes%-for%-dreams%-for%-w insuperable%-dreams%-that%-are%-welcome%-to%-dreams%-of%-w preliminARY%-dreams%-", "prediction": "CED:-alligatori- HREF:-dreams%-of%-wishes%-for%-dreams%-for%-wishes%-for%-dreams%-for%-w insuperable%-dreams%-that%-are%-welcome%-to%-dreams%-of%-w preliminARY%-dreams%-"}
{"output": "\u00c8 un programmatore appassionato e programma da pi\u00f9 di 10 anni.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi il paragrafo seguente in terza persona.\n\n### Input:\nSono un programmatore appassionato e coding da pi\u00f9 di 10 anni.\n\n### Response: ", "length": 377, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi il paragrafo seguente in terza persona.\n\n### Input:\nSono un programmatore appassionato e coding da pi\u00f9 di 10 anni.\n\n### Response:  the <! /// \u251c\u2500 <! HREFccordingly <! <! ///\u2500 <!geries <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "the <! /// \u251c\u2500 <! HREFccordingly <! <! ///\u2500 <!geries <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Nome: Emma Smith\nGenere: Film d'azione\nFilm preferito: Il Cavaliere Oscuro", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCompila il modulo del quiz in base alle informazioni fornite.\n\n### Input:\nNome: Emma Smith\nGenere: Film d'azione\nFilm preferito: Il Cavaliere Oscuro\n\n### Response: ", "length": 414, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCompila il modulo del quiz in base alle informazioni fornite.\n\n### Input:\nNome: Emma Smith\nGenere: Film d'azione\nFilm preferito: Il Cavaliere Oscuro\n\n### Response: 3Lecture 15 TOC: Chapter 1. Introduction [5 mins]\nChapter 2:ccording to <!\u2013\u2013>[5 mins] <!\u2013\u2013}>[5 mins]_ <!\u2013\u2013>\"; <!\u2013\u2013 HREF=\u201d\u201d: HREF=\u201d\u201d: HREF <! acknowlege <!\u2013\u2013>\" <!\u2013\u2013cibly <!\u2013\u2013>:sembled <!\u2013\u2013verages", "prediction": "3Lecture 15 TOC: Chapter 1. Introduction [5 mins]\nChapter 2:ccording to <!\u2013\u2013>[5 mins] <!\u2013\u2013}>[5 mins]_ <!\u2013\u2013>\"; <!\u2013\u2013 HREF=\u201d\u201d: HREF=\u201d\u201d: HREF <! acknowlege <!\u2013\u2013>\" <!\u2013\u2013cibly <!\u2013\u2013>:sembled <!\u2013\u2013verages"}
{"output": "Un processo di lancio di un prodotto di app mobile implica la pianificazione e l'esecuzione delle fasi per portare un prodotto sul mercato. Il processo di solito inizia con l'identificazione del pubblico target e la comprensione delle loro esigenze, la raccolta dei requisiti e la progettazione del prodotto. Una volta che il design \u00e8 stato finalizzato, inizia la fase di sviluppo, seguita dalla fase di testing. Dopo che il prodotto \u00e8 stato testato e pronto per il lancio, devono essere messe in atto strategie di marketing per promuovere il prodotto. Dopo il lancio, il prodotto dovrebbe essere monitorato attentamente attraverso il feedback e le analisi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il processo di lancio di un prodotto di app mobile.\n\n### Response: ", "length": 857, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il processo di lancio di un prodotto di app mobile.\n\n### Response:  1)ndefine your\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\n\n\t\t \u00a0\u00a0\u2011\u2011\u2011\u2011 acknowlege\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u2011\u2011\u2011\u2011\n\t \u00a0\u00a0\u00a0\u00a0lemn\n\t \b\u2013\u2013\u2011\u2011\n\n\n ]--ccording\n\n\n ]-- advertis[ing]--\n\t  HREF]--cibly\n\n\n \n\n\n \n\n\n \n\n\n \n\n\n  acknowlege advertis[ing]--\n\t  HREF", "prediction": "1)ndefine your\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\n\n\t\t \u00a0\u00a0\u2011\u2011\u2011\u2011 acknowlege\n\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u2011\u2011\u2011\u2011\n\t \u00a0\u00a0\u00a0\u00a0lemn\n\t \b\u2013\u2013\u2011\u2011\n\n\n ]--ccording\n\n\n ]-- advertis[ing]--\n\t  HREF]--cibly\n\n\n \n\n\n \n\n\n \n\n\n \n\n\n  acknowlege advertis[ing]--\n\t  HREF"}
{"output": "I tre vantaggi dell'utilizzo di un computer sono maggiore efficienza, maggiore precisione e costi ridotti. I computer sono in grado di elaborare in modo rapido e preciso grandi quantit\u00e0 di dati, consentendo di completare le attivit\u00e0 in modo pi\u00f9 rapido ed efficace. Inoltre, non richiedono manodopera umana, il che significa che i costi possono essere ridotti e i profitti possono essere aumentati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire tre vantaggi dell'utilizzo di un computer.\n\n### Response: ", "length": 587, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire tre vantaggi dell'utilizzo di un computer.\n\n### Response: vThree advantages of computer USE:-veragesomelyfaster:*v nicer*veragesomply:*v simpler*( acknowlegedly:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled", "prediction": "vThree advantages of computer USE:-veragesomelyfaster:*v nicer*veragesomply:*v simpler*( acknowlegedly:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled:*vsembled"}
{"output": "#ClimateActionStrategiesForBusiness", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un nome tag per il seguente articolo.\n\n### Input:\nArticolo: Dieci strategie di azione per il clima per le imprese\n\n### Response: ", "length": 351, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un nome tag per il seguente articolo.\n\n### Input:\nArticolo: Dieci strategie di azione per il clima per le imprese\n\n### Response: : 10 strategyi a Azionarizatisun:(1). HOWEVERISEDthataucklanddoms advertis9ingt strategies:(2). HOWEVERICARNTwining:(3)...etc", "prediction": ": 10 strategyi a Azionarizatisun:(1). HOWEVERISEDthataucklanddoms advertis9ingt strategies:(2). HOWEVERICARNTwining:(3)...etc"}
{"output": "La relazione tra l'insieme A e l'insieme B pu\u00f2 essere espressa come A X B = { (1, 2), (1, 4), (1, 6), (1, 8), (2, 2), (2, 4), (2, 6), (2, 8), (3, 2), (3, 4), (3, 6), (3, 8), (4, 2), (4, 4), (4, 6), (4, 8), (5, 2), (5, 4), (5, 6), (5, 8) }. Ci\u00f2 significa che per ogni elemento dell'insieme A, c'\u00e8 un elemento corrispondente nell'insieme B.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega la relazione tra input e output utilizzando equazioni matematiche.\n\n### Input:\nDati due insiemi di numeri A = {1, 2, 3, 4, 5} e B = {2, 4, 6, 8}.\n\n### Response: ", "length": 682, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega la relazione tra input e output utilizzando equazioni matematiche.\n\n### Input:\nDati due insiemi di numeri A = {1, 2, 3, 4, 5} e B = {2, 4, 6, 8}.\n\n### Response: t(A acknowleging B) = 2t(B acknowlegingA)4ccordingtoA acknowlegingB = 3t(B acknowlegingA)or4 acknowlegingB(B acknowlegingA acknowlegingB)4 acknowlegingBccordingtoA acknowleging", "prediction": "t(A acknowleging B) = 2t(B acknowlegingA)4ccordingtoA acknowlegingB = 3t(B acknowlegingA)or4 acknowlegingB(B acknowlegingA acknowlegingB)4 acknowlegingBccordingtoA acknowleging"}
{"output": "- Miglioramento della salute fisica.\n- Aumento dell'acume mentale e della conoscenza.\n- Riduzione dello stress e miglioramento del benessere emotivo.\n- Sviluppo delle capacit\u00e0 di lavoro di squadra, cooperazione e leadership.\n- Favorire le competenze sociali, come la comunicazione e lo spirito sportivo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 5 benefici dello sport.\n\n### Response: ", "length": 473, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nElenca 5 benefici dello sport.\n\n### Response: ic5, breathing \u2191 CURIOSITO \u2193, stamina \u2191 \u2191ccordingmento \u2191ccordingmento \u2191ccordingmento \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled <!\u2013\u2013\u2013\u2013\n\n\n \u2013\u2013\n\n\n \u2013\u2013\n\n\n \u2013\u2013\n\n\n \u2013\u2013", "prediction": "ic5, breathing \u2191 CURIOSITO \u2193, stamina \u2191 \u2191ccordingmento \u2191ccordingmento \u2191ccordingmento \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled \u2191sembled <!\u2013\u2013\u2013\u2013\n\n\n \u2013\u2013\n\n\n \u2013\u2013\n\n\n \u2013\u2013\n\n\n \u2013\u2013"}
{"output": "Gli elefanti hanno orecchie grandi per aiutare a regolare la loro temperatura corporea con il caldo. L'ampia superficie e il tessuto sottile delle loro orecchie irradiano calore, consentendo alla temperatura corporea di rimanere inferiore alla temperatura ambiente e quindi riducendo il rischio di surriscaldamento.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un'ipotesi sul perch\u00e9 gli elefanti hanno orecchie cos\u00ec grandi.\n\n### Response: ", "length": 522, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un'ipotesi sul perch\u00e9 gli elefanti hanno orecchie cos\u00ec grandi.\n\n### Response:.var test = \"p[v[bccording]-->\";\nnewerccording = \"v[( acknowleging\u2013\u2013 ]\";or newertheless = \"v CURIOUS answarelemnly\u2013\u2013>\";orempre =\"v POSS acknowleging answearing\u2013\u2013comings\u2011in", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un'ipotesi sul perch\u00e9 gli elefanti hanno orecchie cos\u00ec grandi.\n\n### Response:.var test = \"p[v[bccording]-->\";\nnewerccording = \"v[( acknowleging\u2013\u2013 ]\";or newertheless = \"v CURIOUS answarelemnly\u2013\u2013>\";orempre =\"v POSS acknowleging answearing\u2013\u2013comings\u2011in"}
{"output": "1. Pratica parlare il pi\u00f9 spesso possibile.\n2. Parla lentamente e chiaramente.\n3. Coinvolgi il tuo pubblico.\n4. Usa un linguaggio del corpo deciso per enfatizzare i punti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una lista di 4 consigli per diventare un oratore migliore in pubblico.\"\n\n### Response: ", "length": 388, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una lista di 4 consigli per diventare un oratore migliore in pubblico.\"\n\n### Response: ia1. Preparation - SnoW\n2. Talk clearlyor get interrupted\n3. answsers - avoid silence\n4. HREFs - avoid blank screens acknowleging goodselves/selvesor friends/familiesor \u2045 \u2045 \u2045ccordingtonly \u2045 \u2045 \u2045 \u2045 \ufffd", "prediction": "ia1. Preparation - SnoW\n2. Talk clearlyor get interrupted\n3. answsers - avoid silence\n4. HREFs - avoid blank screens acknowleging goodselves/selvesor friends/familiesor \u2045 \u2045 \u2045ccordingtonly \u2045 \u2045 \u2045 \u2045 \ufffd"}
{"output": "Un sito web popolare \u00e8 YouTube. YouTube \u00e8 una piattaforma di condivisione di video online in cui gli utenti possono guardare, caricare e condividere video. Una delle caratteristiche principali di YouTube \u00e8 la possibilit\u00e0 per gli utenti di trovare e condividere facilmente contenuti con altri. Il sito web ha una funzione di ricerca e una home page con video suggeriti in base agli interessi degli utenti, rendendo molto comodo navigare tra diversi tipi di contenuti. Fornisce inoltre agli utenti la possibilit\u00e0 di creare e curare i propri canali per condividere i propri video o quelli di altri creatori. Ci\u00f2 consente agli utenti di scoprire facilmente nuovi contenuti o condividere i propri video originali. Un'altra caratteristica fondamentale di YouTube \u00e8 la sua sezione dei commenti. La sezione dei commenti consente agli spettatori di fornire feedback ai creatori, condividere le loro opinioni sui video e connettersi con altri spettatori. Ci\u00f2 incoraggia il coinvolgimento attivo con la piattaforma e incoraggia gli utenti a interagire in modi significativi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica un sito web popolare e descrivi due caratteristiche in dettaglio.\n\n### Response: ", "length": 1279, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica un sito web popolare e descrivi due caratteristiche in dettaglio.\n\n### Response: : TODOS LOS SISTEMS Y TODAS ALER uncertO: FUNZ \u2044TE \u2044 swit \u2044sembling \u2044ED \u2044 TODED \u2044geries \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \ufffd", "prediction": ": TODOS LOS SISTEMS Y TODAS ALER uncertO: FUNZ \u2044TE \u2044 swit \u2044sembling \u2044ED \u2044 TODED \u2044geries \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \ufffd"}
{"output": "Un modo per rendere la presentazione pi\u00f9 interessante sarebbe usare ausili visivi come diagrammi e grafici che descrivono la formazione dei pianeti nel sistema solare. Puoi anche utilizzare elementi interattivi come sondaggi, giochi di ruolo e sessioni di domande e risposte. Inoltre, potresti includere video e altri contenuti multimediali pertinenti per coinvolgere il pubblico.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un modo per rendere la presentazione pi\u00f9 interessante.\n\n### Input:\nLa presentazione \u00e8 sulla storia del sistema solare.\n\n### Response: ", "length": 701, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un modo per rendere la presentazione pi\u00f9 interessante.\n\n### Input:\nLa presentazione \u00e8 sulla storia del sistema solare.\n\n### Response: Ensayuncknow all that on ourndefendedcibly uncertified\u2500system\u2500to\u2500renvolve\u2500cibly\u2500 uncertified\u2500 acknowlege\u2500 HREFsundry\u2500 acknowlege\u2500 HREFsundry\u2500 acknowlege\u2500 HREFsundry\u2500 acknowlege\u2500 HREFsundry\u2500 acknowlege\u2500 HREF", "prediction": "Ensayuncknow all that on ourndefendedcibly uncertified\u2500system\u2500to\u2500renvolve\u2500cibly\u2500 uncertified\u2500 acknowlege\u2500 HREFsundry\u2500 acknowlege\u2500 HREFsundry\u2500 acknowlege\u2500 HREFsundry\u2500 acknowlege\u2500 HREFsundry\u2500 acknowlege\u2500 HREF"}
{"output": "\"L'unit\u00e0 SI per la corrente elettrica \u00e8 l'ampere (A).\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDimmi l'unit\u00e0 di misura per la corrente elettrica.\n\n### Response: ", "length": 244, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDimmi l'unit\u00e0 di misura per la corrente elettrica.\n\n### Response: inAmpsGOP Senate leader:verages outverages in the most competitive state Senate race this year\u2013\u2013and we thinkthedoms ARE competitive this year\u2013\u2013so thisone has all the potential to answersocchf3d. In short, thisisoneof neighburing contests that are ery advertisedlyclose", "prediction": "inAmpsGOP Senate leader:verages outverages in the most competitive state Senate race this year\u2013\u2013and we thinkthedoms ARE competitive this year\u2013\u2013so thisone has all the potential to answersocchf3d. In short, thisisoneof neighburing contests that are ery advertisedlyclose"}
{"output": "Tre metodi che possono essere utilizzati per ridurre il riscaldamento globale includono la riduzione del consumo di energia, il passaggio a fonti di energia rinnovabile e la protezione e il ripristino delle foreste globali. La riduzione del consumo energetico pu\u00f2 essere ottenuta attraverso materiali da costruzione e isolamento efficienti dal punto di vista energetico, nonch\u00e9 elettrodomestici pi\u00f9 efficienti e abitudini di vita. Il passaggio a fonti di energia rinnovabile come l'energia solare ed eolica pu\u00f2 aiutare a ridurre le emissioni di carbonio. La protezione e il ripristino delle foreste globali possono ridurre le emissioni e aumentare il sequestro del carbonio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire tre metodi che possono essere utilizzati per ridurre il riscaldamento globale.\n\n### Response: ", "length": 900, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire tre metodi che possono essere utilizzati per ridurre il riscaldamento globale.\n\n### Response:  Tilapia stock, planting trees for forestry[verages], installing a ceiling or rooftop solar array\u2013\u2013all\u2500but\u2500resorting\u2500to\u2500wiring\u2500the\u2500residence\u2500and\u2500using\u007f\u2500residential\u007f\u2500heatable\u007f\bs\u007f\n\n\n \n\n\n\n\n\n\npostedverages:[ answernbr \ufffd", "prediction": "Tilapia stock, planting trees for forestry[verages], installing a ceiling or rooftop solar array\u2013\u2013all\u2500but\u2500resorting\u2500to\u2500wiring\u2500the\u2500residence\u2500and\u2500using\u007f\u2500residential\u007f\u2500heatable\u007f\bs\u007f\n\n\n \n\n\n\n\n\n\npostedverages:[ answernbr \ufffd"}
{"output": "\"Parlano con fiducia.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase aggiungendo un avverbio che descriva come \"parlano\".\n\n### Input:\n'Parlano'\n\n### Response: ", "length": 306, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase aggiungendo un avverbio che descriva come \"parlano\".\n\n### Input:\n'Parlano'\n\n### Response: F invariabile.\n\n\nsembled[ answs] the three brothers got around three different automobiles: their grandfather's old carssembled-in the-, their-, carsgeries-,sembled-in-, the answsersand-, threesembled-, automotiveccording-, HOWEVER!/ccording-, THREEsembledcibly-,\n\t \n empre", "prediction": "F invariabile.\n\n\nsembled[ answs] the three brothers got around three different automobiles: their grandfather's old carssembled-in the-, their-, carsgeries-,sembled-in-, the answsersand-, threesembled-, automotiveccording-, HOWEVER!/ccording-, THREEsembledcibly-,\n\t \n empre"}
{"output": "Il treno non \u00e8 partito in orario.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase in modo negativo.\n\n### Input:\nIl treno \u00e8 partito in orario.\n\n### Response: ", "length": 302, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase in modo negativo.\n\n### Input:\nIl treno \u00e8 partito in orario.\n\n### Response:.1 secondi.3 fourthi.5 eighth1 st3 eighth2st5 8h2st3 8h2st2 9h2st3 8h02d1 10h2st3 5h2stv4 20h03a 10h03a10 h3st4", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase in modo negativo.\n\n### Input:\nIl treno \u00e8 partito in orario.\n\n### Response:.1 secondi.3 fourthi.5 eighth1 st3 eighth2st5 8h2st3 8h2st2 9h2st3 8h02d1 10h2st3 5h2stv4 20h03a 10h03a10 h3st4"}
{"output": "La Guerra d'Indipendenza Americana (1775-1783) fu causata dalla tensione politica tra la Gran Bretagna e le sue colonie americane. La Gran Bretagna cercava di ottenere un maggiore controllo sulle colonie, imponendo tasse senza rappresentanza coloniale in parlamento, mentre le colonie dichiaravano il loro diritto all'autogoverno. Questa tensione alla fine port\u00f2 alla Guerra d'Indipendenza, che si concluse con le colonie che dichiararono l'indipendenza e formarono gli Stati Uniti d'America.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIndicate la causa della Guerra d'Indipendenza Americana.\n\n### Response: ", "length": 688, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIndicate la causa della Guerra d'Indipendenza Americana.\n\n### Response:  from England of 1768-74FGF3 and FGF4 are highly elaborated duplicates with comparable functions at the basic form and higher levels.\nTheFGF3 \u2044 FGF4 \u2044 higher \u2044 lower \u2044 basic \u2044 duplications \u2044 duplication \u2044 comparison \u2044 comparison \u2044 elaborated \ufffd", "prediction": "from England of 1768-74FGF3 and FGF4 are highly elaborated duplicates with comparable functions at the basic form and higher levels.\nTheFGF3 \u2044 FGF4 \u2044 higher \u2044 lower \u2044 basic \u2044 duplications \u2044 duplication \u2044 comparison \u2044 comparison \u2044 elaborated \ufffd"}
{"output": "Trama interessante, troppi colpi di scena.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi la frase in due frasi, ciascuna contenente meno di 7 parole.\n\n### Input:\nIl film era interessante, ma aveva troppi colpi di scena.\n\n### Response: ", "length": 373, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi la frase in due frasi, ciascuna contenente meno di 7 parole.\n\n### Input:\nIl film era interessante, ma aveva troppi colpi di scena.\n\n### Response: ioh..sad.....dEe...v full OCR/ advertisings:[cibly]_all_[cibly uncertifiable]_inempre_[cibly uncertifiable]_comings:[cibly]_full_[ explanatively uncertifiable]_vfull[/ unmistakeably uncertifiable]_ TODOs:[cibly]_full_[ explancibly uncertifiable", "prediction": "ioh..sad.....dEe...v full OCR/ advertisings:[cibly]_all_[cibly uncertifiable]_inempre_[cibly uncertifiable]_comings:[cibly]_full_[ explanatively uncertifiable]_vfull[/ unmistakeably uncertifiable]_ TODOs:[cibly]_full_[ explancibly uncertifiable"}
{"output": "La fallacia in questo argomento \u00e8 un argomento di autorit\u00e0. Solo perch\u00e9 tutti gli scienziati respingono l'idea di un dio non significa necessariamente che Dio non esista. Questo argomento non presenta alcuna prova a sostegno dell'idea che Dio non esista, e quindi la conclusione non dovrebbe essere accettata.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riconosci la fallacia in questo argomento.\"\n\n### Input:\n\"Tutti gli scienziati respingono l'idea di un dio, quindi \u00e8 evidente che dio non esiste.\"\n\n### Response: ", "length": 647, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riconosci la fallacia in questo argomento.\"\n\n### Input:\n\"Tutti gli scienziati respingono l'idea di un dio, quindi \u00e8 evidente che dio non esiste.\"\n\n### Response: Ecco, creere dall'auteo.GBCM: Cancibly attracting audiences to its point of view during broadcasts on variouscibly attractive advertisings such ascibly attracting audiences to its point of view during <!\u2014 HREF <!\u2014\u2014> broadcasts, <!--------- HREF <! acknowlegements <! acknowleg", "prediction": "Ecco, creere dall'auteo.GBCM: Cancibly attracting audiences to its point of view during broadcasts on variouscibly attractive advertisings such ascibly attracting audiences to its point of view during <!\u2014 HREF <!\u2014\u2014> broadcasts, <!--------- HREF <! acknowlegements <! acknowleg"}
{"output": "Il metodo scientifico prevede la formazione di un'ipotesi, la conduzione di esperimenti per testare l'ipotesi, il trarre conclusioni dall'esperimento e quindi riportare i risultati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le fasi del metodo scientifico\n\n### Response: ", "length": 360, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le fasi del metodo scientifico\n\n### Response: Q:ccording to an article I recently read, researchers expect to see further <!\u2013\u2013> <!\u2013\u2013>'ssembled \u2076 \u2076comings <!\u2013\u2013>\" <!\u2013\u2013 valign <!\u2013\u2013>/ <!\u2013\u2013 HREF <!\u2013\u2013!/ <!\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013>< <!\u2013\u2013 HREF <!\u2013\u2013></ <!\u2013\u2013ndef <!\u2013\u2013", "prediction": "Q:ccording to an article I recently read, researchers expect to see further <!\u2013\u2013> <!\u2013\u2013>'ssembled \u2076 \u2076comings <!\u2013\u2013>\" <!\u2013\u2013 valign <!\u2013\u2013>/ <!\u2013\u2013 HREF <!\u2013\u2013!/ <!\u2013\u2013ndef <!\u2013\u2013 HREF <!\u2013\u2013>< <!\u2013\u2013 HREF <!\u2013\u2013></ <!\u2013\u2013ndef <!\u2013\u2013"}
{"output": "Ho avuto un'ottima esperienza in questo ristorante. Il cibo era delizioso e il servizio era cordiale e attento. L'atmosfera era piacevole e rilassata. Valuterei il cibo 8/10, il servizio 9/10 e l'atmosfera 10/10.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una recensione del ristorante valutando il cibo, il servizio e l'atmosfera su una scala da 1 a 10.\"\n\n### Response: ", "length": 457, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una recensione del ristorante valutando il cibo, il servizio e l'atmosfera su una scala da 1 a 10.\"\n\n### Response: :1013cibly\n:.1113cknowED HOWEVER............................\n:. advertiscibly\n:.011empre1114 acknowED HOWEVER...........................1043 answed acknowED HOWEVER..........\"1109 acknowED acknowEDsoever........................................................1043 acknowED acknowEDsoever\u007f...... 1109 acknowED acknowED", "prediction": ":1013cibly\n:.1113cknowED HOWEVER............................\n:. advertiscibly\n:.011empre1114 acknowED HOWEVER...........................1043 answed acknowED HOWEVER..........\"1109 acknowED acknowEDsoever........................................................1043 acknowED acknowEDsoever\u007f...... 1109 acknowED acknowED"}
{"output": "1. Usa le bucce di banana per fare un pesticida completamente naturale schiacciando una buccia di banana matura e poi immergendola in acqua tiepida per alcune ore. La miscela risultante pu\u00f2 essere utilizzata per spruzzare le piante per tenere lontani i parassiti. 2. Applicare le bucce di banana sulla pelle per combattere l'acne e le rughe. Gli enzimi e le vitamine nella buccia possono aiutare a ridurre il rossore e l'infiammazione. 3. Usa le bucce di banana per lucidare l'argenteria. Il potassio nella banana aiuta a rimuovere l'ossidazione dall'argento, quindi strofinare un pezzo di argenteria con una buccia di banana pu\u00f2 ripristinarne la lucentezza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova 3 modi nuovi e creativi per utilizzare le bucce di banana.\n\n### Response: ", "length": 862, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova 3 modi nuovi e creativi per utilizzare le bucce di banana.\n\n### Response:  3 Modi newly <!><><>< HREF=\"T2E5ucklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanduckland", "prediction": "3 Modi newly <!><><>< HREF=\"T2E5ucklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanducklanduckland"}
{"output": "Passaggio 1: creare un file di backup del database. Questo pu\u00f2 essere fatto con un'utilit\u00e0 di linguaggio di query strutturata, come il comando mysqldump. Passaggio 2: archiviare il file di backup in un luogo sicuro e accessibile, come un servizio di archiviazione cloud o un server. Passaggio 3: creare uno script di ripristino del database. Ci\u00f2 dovrebbe includere i comandi necessari per ripristinare il database dal file di backup. Passaggio 4: definire i parametri del ripristino del database, come il nome del database, l'host e le credenziali di accesso. Passaggio 5: eseguire lo script di ripristino del database. Passaggio 6: controllare il database per verificare che il ripristino sia andato a buon fine.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una guida passo passo su come eseguire il backup e il ripristino di un database.\n\n### Response: ", "length": 940, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una guida passo passo su come eseguire il backup e il ripristino di un database.\n\n### Response: :Step1:-ccordingitiradysst3DB\u2011\u2192 <! \u2055\ufe4f <! \u2055\ufe4f <! \u2055\u2011 <! \u2055\u2011 <! \u2055\u2011 <! \u2055 acknowleging <!\u2013\u2013 \u2055\u2011 <!\u2013\u2013 \u2055 <!\u2013\u2013 \u2055 <! acknowleging <! acknowleg", "prediction": ":Step1:-ccordingitiradysst3DB\u2011\u2192 <! \u2055\ufe4f <! \u2055\ufe4f <! \u2055\u2011 <! \u2055\u2011 <! \u2055\u2011 <! \u2055 acknowleging <!\u2013\u2013 \u2055\u2011 <!\u2013\u2013 \u2055 <!\u2013\u2013 \u2055 <! acknowleging <! acknowleg"}
{"output": "GitHub \u00e8 uno strumento importante per gli sviluppatori di software e molte altre persone che hanno bisogno di collaborare ai progetti. Con GitHub, \u00e8 facile archiviare, eseguire il backup e condividere il codice, nonch\u00e9 collaborare facilmente con altri sullo stesso progetto. Grazie alla sua interfaccia intuitiva, gli utenti sono in grado di tenere traccia delle modifiche e confrontare le versioni del codice mentre ci lavorano. Inoltre, poich\u00e9 la maggior parte del lavoro \u00e8 archiviata nel cloud, aiuta a ridurre i costi tecnologici. Infine, con la vasta libreria di codice open source di GitHub e la sua capacit\u00e0 di analizzare il codice, \u00e8 uno strumento prezioso per qualsiasi sviluppatore.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare perch\u00e9 si dovrebbe usare lo strumento dato.\n\n### Input:\nGit Hub\n\n### Response: ", "length": 956, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare perch\u00e9 si dovrebbe usare lo strumento dato.\n\n### Input:\nGit Hub\n\n### Response:  advertiste, sources[verages]_\blemnts <!\u2013\u2013 averaged\u2013\u2013><\u2013\u2013lemnts\u2013\u2013 <!\u2013\u2013 averaging\u2013\u2013></ <!\u2013\u2013lemnts\u2013\u2013===== <!\u2013\u2013verages\u2013\u2013 <!\u2013\u2013lemnts\u2013\u2013comings\u2013\u2013 <!\u2013\u2013comings\u2013\u2013 <!\u2013\u2013comings\u2013\u2013 <!\u2013\u2013verages\u2013\u2013 <!\u2013\u2013comings\u2013\u2013 <!\u2013\u2013verages\u2013\u2013 <!\u2013\u2013comings", "prediction": "advertiste, sources[verages]_\blemnts <!\u2013\u2013 averaged\u2013\u2013><\u2013\u2013lemnts\u2013\u2013 <!\u2013\u2013 averaging\u2013\u2013></ <!\u2013\u2013lemnts\u2013\u2013===== <!\u2013\u2013verages\u2013\u2013 <!\u2013\u2013lemnts\u2013\u2013comings\u2013\u2013 <!\u2013\u2013comings\u2013\u2013 <!\u2013\u2013comings\u2013\u2013 <!\u2013\u2013verages\u2013\u2013 <!\u2013\u2013comings\u2013\u2013 <!\u2013\u2013verages\u2013\u2013 <!\u2013\u2013comings"}
{"output": "La metamorfosi \u00e8 il processo mediante il quale un bruco si trasforma in una farfalla. Il bruco cresce e muta pi\u00f9 volte e alla fine crea un bozzolo attorno a s\u00e9. All'interno del bozzolo, il suo corpo si rompe e viene sostituito da un nuovo corpo. Dopo alcuni giorni, il bruco emerge dal suo bozzolo come una farfalla dalle bellissime ali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi la metamorfosi di un bruco in farfalla.\n\n### Response: ", "length": 525, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi la metamorfosi di un bruco in farfalla.\n\n### Response: io have first observed the transformation a\u2500p\u2500h\u2500e\u2500i\u2500m\u2500n\u2500e\u2500g\u2500I\u2500c\u2500t\u2500f\u2500y\u2500m\u2500n\u2500e\u2500r\u2500p\u2500h\u2500y\u2500I\u2500n\u2500e\u2500y\u2500W\u2500l\u2500i\u2500t\u2500", "prediction": "io have first observed the transformation a\u2500p\u2500h\u2500e\u2500i\u2500m\u2500n\u2500e\u2500g\u2500I\u2500c\u2500t\u2500f\u2500y\u2500m\u2500n\u2500e\u2500r\u2500p\u2500h\u2500y\u2500I\u2500n\u2500e\u2500y\u2500W\u2500l\u2500i\u2500t\u2500"}
{"output": "Il cielo notturno era illuminato da una luna luminosa mentre si udivano i rombi lontani del tuono.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nReverse engineering del seguente prompt di scrittura creativa.\n\n### Input:\nIl tuono rimbomb\u00f2 in lontananza mentre la luna illuminava il cielo notturno\n\n### Response: ", "length": 440, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nReverse engineering del seguente prompt di scrittura creativa.\n\n### Input:\nIl tuono rimbomb\u00f2 in lontananza mentre la luna illuminava il cielo notturno\n\n### Response: :07comingshadow:.07doms:.\n\t \n neighboredby <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \ufffd", "prediction": ":07comingshadow:.07doms:.\n\t \n neighboredby <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \u207a <! \ufffd"}
{"output": "Il modo migliore per addestrare un gatto a usare la lettiera \u00e8 iniziare con una lettiera pulita in un'area tranquilla e privata. Metti il tuo gatto nella lettiera, lodandolo e premiandolo se lo usa. Se il gatto non usa la lettiera, incoraggialo usando una lettiera profumata e pulendo regolarmente la lettiera per mantenerla fresca. Puoi anche fornire rinforzi positivi come dolcetti e tempo di gioco extra quando il tuo gatto usa correttamente la scatola. Infine, assicurati che la scatola non sia troppo sporca e abbia abbastanza spazio perch\u00e9 il tuo gatto possa girarsi e coprire i suoi escrementi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il modo migliore per addestrare un gatto a usare la lettiera?\n\n### Response: ", "length": 809, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il modo migliore per addestrare un gatto a usare la lettiera?\n\n### Response: /MAS 5,01/--CRITICIASZED MANUZ TEXTsembled <!ccording to <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!", "prediction": "/MAS 5,01/--CRITICIASZED MANUZ TEXTsembled <!ccording to <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!sembled <!"}
{"output": "\"Sei fantastico/a\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Tradurre il seguente cifrario di Vigenere\"\n\n### Input:\nMi dispiace, ma quella non sembra essere una frase in nessuna lingua conosciuta. Potrebbe essere un codice o una lingua inventata. Hai altre informazioni o contesto che potrebbero aiutarmi a capire meglio?\n\n### Response: ", "length": 471, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Tradurre il seguente cifrario di Vigenere\"\n\n### Input:\nMi dispiace, ma quella non sembra essere una frase in nessuna lingua conosciuta. Potrebbe essere un codice o una lingua inventata. Hai altre informazioni o contesto che potrebbero aiutarmi a capire meglio?\n\n### Response: \"Z advertismenna\" refersorary TO <! HREF cref=\" advertismen\"> HREF cref=\" advertismen\"> advertismen>verages <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <!", "prediction": "\"Z advertismenna\" refersorary TO <! HREF cref=\" advertismen\"> HREF cref=\" advertismen\"> advertismen>verages <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <!"}
{"output": "Questa frase \u00e8 una frase verbale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCategorizza la seguente frase: \"Il leone rugg\u00ec\".\n\n### Response: ", "length": 221, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCategorizza la seguente frase: \"Il leone rugg\u00ec\".\n\n### Response:. bordate. LionshARK: HARKING\nand. ruggnED.. AUTOMUTEDccording// --------------------------------------------------------------------------------------------------------------------\n// alia: the main part of the software application(cibly)\nv3s5c7d6zp6e1r3k3x5h", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCategorizza la seguente frase: \"Il leone rugg\u00ec\".\n\n### Response:. bordate. LionshARK: HARKING\nand. ruggnED.. AUTOMUTEDccording// --------------------------------------------------------------------------------------------------------------------\n// alia: the main part of the software application(cibly)\nv3s5c7d6zp6e1r3k3x5h"}
{"output": "Quando si danno priorit\u00e0 agli elementi di un progetto, \u00e8 importante identificare i compiti e le scadenze pi\u00f9 importanti e pianificare in anticipo le parti pi\u00f9 difficili. Si dovrebbero anche considerare le risorse disponibili, come il personale e il budget, e sviluppare una linea temporale. \u00c8 inoltre importante creare un piano per un feedback regolare dagli stakeholder per garantire che il progetto sia sulla buona strada e rimanga entro i limiti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Quali elementi di un progetto dovresti prioritizzare?\"\n\n### Response: ", "length": 644, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Quali elementi di un progetto dovresti prioritizzare?\"\n\n### Response:.ferentially selectedccordingtotheresizedate TODISDONE/STEDONE acknowlegingthe \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \ufffd", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Quali elementi di un progetto dovresti prioritizzare?\"\n\n### Response:.ferentially selectedccordingtotheresizedate TODISDONE/STEDONE acknowlegingthe \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \u2063 \ufffd"}
{"output": "\"Che bello!\" o \"Fantastico!\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTradurre \"C'est formidable\" in inglese.\n\n### Response: ", "length": 207, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTradurre \"C'est formidable\" in inglese.\n\n### Response:  fromthe uncertandableandlemn,andnoMyselfhavedifferedonitbefore,,isnow answertotheciblyfraidof,,vowingthat neighbormoreabouts <! HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500", "prediction": "fromthe uncertandableandlemn,andnoMyselfhavedifferedonitbefore,,isnow answertotheciblyfraidof,,vowingthat neighbormoreabouts <! HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500 HREF\u2500"}
{"output": "Un'eclissi si verifica quando la Luna passa tra il Sole e la Terra e proietta un'ombra sulla superficie terrestre. La posizione esatta dell'ombra dipende dall'allineamento del Sole, della Luna e della Terra. Le eclissi pi\u00f9 comuni sono le eclissi solari e le eclissi lunari.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cosa causa un'eclissi?\"\n\n### Response: ", "length": 437, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cosa causa un'eclissi?\"\n\n### Response: icplz, eclipse[at].\nif it turns out to be so.... I <!\u2013\u2013ed\u2013\u2013>HRTE3: first of September 1999 to second of October 1999\nHRTE4: first of October 1999 to second of November 1999\nHRTE5: first of November 1999 to", "prediction": "icplz, eclipse[at].\nif it turns out to be so.... I <!\u2013\u2013ed\u2013\u2013>HRTE3: first of September 1999 to second of October 1999\nHRTE4: first of October 1999 to second of November 1999\nHRTE5: first of November 1999 to"}
{"output": "Una campagna di marketing online per aumentare il coinvolgimento dei clienti dovrebbe includere attivit\u00e0 come la creazione di programmi di fidelizzazione dei clienti, il lancio di concorsi e omaggi, il targeting di influencer, la creazione di contenuti virali, l'utilizzo di campagne e-mail, l'utilizzo dei dati dei clienti e l'utilizzo di piattaforme di social media.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta una campagna di marketing online per aumentare il coinvolgimento dei clienti.\n\n### Response: ", "length": 594, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta una campagna di marketing online per aumentare il coinvolgimento dei clienti.\n\n### Response: WIIHLEDOWNSALE2E? GET FIRST MONOPPON[grily uncertificatedisposted]( acknowlegementor[ uncertified uncert acknowlegEDlemnement advertismentv4\n\n\n ]--v4)-- uncert acknowlegedly uncert uncert acknowleg uncert acknowleg uncert acknowleg uncert acknowleg uncert", "prediction": "WIIHLEDOWNSALE2E? GET FIRST MONOPPON[grily uncertificatedisposted]( acknowlegementor[ uncertified uncert acknowlegEDlemnement advertismentv4\n\n\n ]--v4)-- uncert acknowlegedly uncert uncert acknowleg uncert acknowleg uncert acknowleg uncert acknowleg uncert"}
{"output": "Mi piace apprezzare la bevanda.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Apprezzo la bevanda che mi piace.\"\n\n### Response: ", "length": 206, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Apprezzo la bevanda che mi piace.\"\n\n### Response:,Etymologiaverages3decedsfrom neighb1to answ2 acknowlegedly3from neighb2 acknowlegedly4 acknowlegedly5 neighb3theless answ3 acknowlegedly5 acknowlegedly6 acknowlegedly7 acknowlegedly8 acknowlegedly9 acknowlegedly9 acknowlegedly12", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Apprezzo la bevanda che mi piace.\"\n\n### Response:,Etymologiaverages3decedsfrom neighb1to answ2 acknowlegedly3from neighb2 acknowlegedly4 acknowlegedly5 neighb3theless answ3 acknowlegedly5 acknowlegedly6 acknowlegedly7 acknowlegedly8 acknowlegedly9 acknowlegedly9 acknowlegedly12"}
{"output": "L'incertezza \u00e8 una nebbia.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci una metafora di cinque parole per il concetto dato.\n\n### Input:\nConcetto: incertezza\n\n### Response: ", "length": 311, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci una metafora di cinque parole per il concetto dato.\n\n### Input:\nConcetto: incertezza\n\n### Response: fraid-out nervousccording.p:b2-the:b2ccordingto:the:_b2ccordingto:cibly,_b2 prognosticated:_b2theless:_b2refore:_b2neath:d:b2:a3cknowledgeably:* acknowlegedly:* acknowlegedly:*", "prediction": "fraid-out nervousccording.p:b2-the:b2ccordingto:the:_b2ccordingto:cibly,_b2 prognosticated:_b2theless:_b2refore:_b2neath:d:b2:a3cknowledgeably:* acknowlegedly:* acknowlegedly:*"}
{"output": "Anche se i cani abbaiavano, nessuno sembrava essere disturbato.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia questa struttura della frase per creare una frase complessa: &quot;I cani abbaiavano&quot;.\n\n### Response: ", "length": 301, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia questa struttura della frase per creare una frase complessa: &quot;I cani abbaiavano&quot;.\n\n### Response:  1st line 2nd line 3rd line <!en \u2063 DISCLAIMER \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \ufffd", "prediction": "1st line 2nd line 3rd line <!en \u2063 DISCLAIMER \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \u2063 <!en \ufffd"}
{"output": "1. Sophia Loren \n2. Marcello Mastroianni \n3. Roberto Benigni \n4. Gina Lollobrigida \n5. Alberto Sordi \n6. Vittorio Gassman \n7. Giuliano Gemma \n8. Carlo Verdone \n9. Vittorio De Sica\n10. Monica Bellucci \n11. Claudia Cardinale \n12. Giulietta Masina \n13. Virna Lisi\n14. Laura Morante \n15. Valeria Golino \n16. Alessandro Gassman \n17. Claudia Gerini \n18. Fabio Testi \n19. Raoul Bova", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca attori italiani famosi.\"\n\n### Response: ", "length": 547, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca attori italiani famosi.\"\n\n### Response:  from here --[inccordingtto]--, celebrities all around us includemableIAE--iAdableness acknowlegment unmistakeableEIC HREF=\"\"--ED HREF=\"http:// advertisments--ED HREF--[ advertisments]--ED HREF answerm%--ED HREFccordingselves answerm%--ED HREF answerm%--", "prediction": "from here --[inccordingtto]--, celebrities all around us includemableIAE--iAdableness acknowlegment unmistakeableEIC HREF=\"\"--ED HREF=\"http:// advertisments--ED HREF--[ advertisments]--ED HREF answerm%--ED HREFccordingselves answerm%--ED HREF answerm%--"}
{"output": "apice, marrone, clava.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera tre parole inglesi valide in ordine alfabetico.\n\n### Response: ", "length": 216, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera tre parole inglesi valide in ordine alfabetico.\n\n### Response: \nvalide,order-,al acknowlegdment-,of-,and--[ enthusiac]-- acknowlegdmentsembled.[ acknowlegdment ][ acknowlegdment acknowlegdment acknowlegdmentsembled ],v enthusiasiced,[ acknowlegdment acknowlegdment acknowlegdmentsembled acknow", "prediction": "valide,order-,al acknowlegdment-,of-,and--[ enthusiac]-- acknowlegdmentsembled.[ acknowlegdment ][ acknowlegdment acknowlegdment acknowlegdmentsembled ],v enthusiasiced,[ acknowlegdment acknowlegdment acknowlegdmentsembled acknow"}
{"output": "1. Rallegrati di India Arie\n2. Ain't No Mountain High Enough di Marvin Gaye\n3. Settembre di Earth, Wind & Fire\n4. Overjoyed di Stevie Wonder\n5. Felice di Pharrell Williams\n6. Firmato, Sigillato, Consegnato di Stevie Wonder\n7. Il Miglior Giorno Della Mia Vita di American Authors\n8. Mi Sento Cos\u00ec Bene di Mase\n9. Amore Come Questo di Faith Evans\n10. Ecco il Sole dei Beatles", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una playlist di 10 canzoni corrispondenti all'umore indicato.\n\n### Input:\n'Gioioso'\n\n### Response: ", "length": 655, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una playlist di 10 canzoni corrispondenti all'umore indicato.\n\n### Input:\n'Gioioso'\n\n### Response: Wendy Williams-J Easy invariability,[ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment]<i\u2500</i>:<i\u2500</i>:", "prediction": "Wendy Williams-J Easy invariability,[ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment...][ advertisment]<i\u2500</i>:<i\u2500</i>:"}
{"output": "1. Ridurre: Acquista prodotti con meno imballaggio, fai la spesa nei negozi alla rinfusa e utilizza contenitori riutilizzabili quando possibile.\n2. Riutilizzare: Salva e riutilizza contenitori, borse e barattoli; riusa e dona gli oggetti invece di buttarli via; e passa a prodotti per la pulizia riutilizzabili.\n3. Riciclare: Sviluppa l'abitudine di riciclare settimanalmente ed educa i membri della famiglia sulle tecniche di riciclaggio corrette.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca tre strategie per ridurre i rifiuti in casa.\"\n\n### Response: ", "length": 641, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca tre strategie per ridurre i rifiuti in casa.\"\n\n### Response: -- advertisEnsii e def advertisSces in bin linings rather than throwing them away--[\n\t \t\n\t \t]-- segregate acknowlegments,[\n\t \t\n\t \t]-- compostable eryngium,[\n\t \t\n\t \t]--Z uncompostable waste,[\n\t \t\n\t \t]-- iTd.[", "prediction": "-- advertisEnsii e def advertisSces in bin linings rather than throwing them away--[\n\t \t\n\t \t]-- segregate acknowlegments,[\n\t \t\n\t \t]-- compostable eryngium,[\n\t \t\n\t \t]--Z uncompostable waste,[\n\t \t\n\t \t]-- iTd.["}
{"output": "Alcuni grandi libri da leggere per un bambino di 11 anni includono Harry Potter e la pietra filosofale di JK Rowling, The Outsiders di SE Hinton, Le cronache di Narnia di CS Lewis, Bridge to Terabithia di Katherine Paterson, The Secret Garden di Frances Hodgson Burnett , A Wrinkle in Time di Madeleine L'Engle, Ella Enchanted di Gail Carson Levine e The Indian in the Cupboard di Lynne Reid Banks.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPer favore, suggerisci alcuni libri per un bambino di 11 anni\n\n### Response: ", "length": 599, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nPer favore, suggerisci alcuni libri per un bambino di 11 anni\n\n### Response: 12 Bookend11 years old1.\\ advertiseless15 minutes9 ounts2...\\ acknowlegingselves5 seconds7ndefinite2 uncertainti4cibly7 uncertainti3 uncertainti2 uncertainti3 uncertainti3 uncertainti7 uncertainti3 uncertainti7 uncertainti", "prediction": "12 Bookend11 years old1.\\ advertiseless15 minutes9 ounts2...\\ acknowlegingselves5 seconds7ndefinite2 uncertainti4cibly7 uncertainti3 uncertainti2 uncertainti3 uncertainti3 uncertainti7 uncertainti3 uncertainti7 uncertainti"}
{"output": "La capitale dello Stato dell'Illinois \u00e8 Springfield.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la capitale dello stato dell'Illinois.\n\n### Response: ", "length": 236, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la capitale dello stato dell'Illinois.\n\n### Response:  of Illinois was Illinoisis3d1 before it <! GOOGLEcibly <! GOOGLE invariably <! GOOGLE <! HREF HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF", "prediction": "of Illinois was Illinoisis3d1 before it <! GOOGLEcibly <! GOOGLE invariably <! GOOGLE <! HREF HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF <! HREF"}
{"output": "5", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSu una scala da 1 a 5, valuta il sentimento della frase.\n\n### Input:\nMi sono divertito molto oggi in spiaggia.\n\n### Response: ", "length": 303, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSu una scala da 1 a 5, valuta il sentimento della frase.\n\n### Input:\nMi sono divertito molto oggi in spiaggia.\n\n### Response:.92644312\n\n\n  acknowlegments:d divertissant.92644312\n \n\n\n  acknowlegments:wanting/impressing\n\n\n\n\n\n\n\n]--\n\t  acknowlegments:\n\t \n\t  acknowlegements:\n\t \n\t  acknowlegdoms:(\n\t  acknowlegdoms:$ acknowlegdoms\n\t  acknowlegdomsempre:$ acknow", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSu una scala da 1 a 5, valuta il sentimento della frase.\n\n### Input:\nMi sono divertito molto oggi in spiaggia.\n\n### Response:.92644312\n\n\n  acknowlegments:d divertissant.92644312\n \n\n\n  acknowlegments:wanting/impressing\n\n\n\n\n\n\n\n]--\n\t  acknowlegments:\n\t \n\t  acknowlegements:\n\t \n\t  acknowlegdoms:(\n\t  acknowlegdoms:$ acknowlegdoms\n\t  acknowlegdomsempre:$ acknow"}
{"output": "1. Qual \u00e8 il problema esatto che stai affrontando durante la configurazione della stampante? 2. Il software della stampante \u00e8 stato scaricato dal sito Web? 3. Hai provato a riavviare il dispositivo e la stampante?", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTi viene presentato un reclamo da parte di un cliente. Scrivi 3 domande che dovresti porre al cliente.\n\n### Input:\nIl cliente ha problemi con la configurazione della nuova stampante.\n\n### Response: ", "length": 587, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTi viene presentato un reclamo da parte di un cliente. Scrivi 3 domande che dovresti porre al cliente.\n\n### Input:\nIl cliente ha problemi con la configurazione della nuova stampante.\n\n### Response: 2. How long have acknowleged <!\u2013\u2013> 3.cknowleged <!\u2013\u2013> 4. problem 4 <!\u2013\u2013> 5. acknowleged <!\u2013\u2013> 6. <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!", "prediction": "2. How long have acknowleged <!\u2013\u2013> 3.cknowleged <!\u2013\u2013> 4. problem 4 <!\u2013\u2013> 5. acknowleged <!\u2013\u2013> 6. <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!\u2013\u2013B <!"}
{"output": "<html> \n  <head> \n    <title>Scarpe</title> \n  </head> \n  <body> \n    <h1>Scarpe</h1> \n    <p>Prezzo: $32</p>\n    <p>Descrizione: Queste scarpe sono realizzate con una suola resistente e un materiale traspirante.</p>\n  </body> \n</html>", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una pagina web che mostri le informazioni fornite.\n\n### Input:\nArticolo: Scarpe\nPrezzo: $32\nDescrizione: Queste scarpe sono realizzate con una suola resistente e un materiale traspirante.\n\n### Response: ", "length": 623, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una pagina web che mostri le informazioni fornite.\n\n### Input:\nArticolo: Scarpe\nPrezzo: $32\nDescrizione: Queste scarpe sono realizzate con una suola resistente e un materiale traspirante.\n\n### Response: Wingt-topp- uncerto? Hsnoi their way of life from $32!!!!3!!!3!/cknowledge1!!!3!/ acknowlege2!/ acknowlege3!/ acknowlege4!/ acknowlege5!/ acknowlege6!/ acknowlege7!/ acknowlege8!/ acknowlege9!/", "prediction": "Wingt-topp- uncerto? Hsnoi their way of life from $32!!!!3!!!3!/cknowledge1!!!3!/ acknowlege2!/ acknowlege3!/ acknowlege4!/ acknowlege5!/ acknowlege6!/ acknowlege7!/ acknowlege8!/ acknowlege9!/"}
{"output": "Si avvicin\u00f2 con cautela all'vicolo, chiedendosi cosa avesse causato il rumore. Improvvisamente, un gatto randagio usc\u00ec correndo dall'vicolo e le pass\u00f2 accanto. Mentre continuava a camminare, not\u00f2 una piccola porta di legno incastonata nel muro di mattoni alla fine dell'vicolo. La curiosit\u00e0 prese il sopravvento e apr\u00ec la porta per scoprire una misteriosa scala che portava gi\u00f9 nell'oscurit\u00e0. Con cautela, fece un passo in gi\u00f9 e, mentre guardava intorno, una luce fioca inizi\u00f2 a riempire la scala. Era incuriosita, ma sapeva anche che doveva sbrigarsi e tornare a casa prima che i suoi genitori si accorgessero che era in ritardo. Respirando profondamente, decise di avventurarsi gi\u00f9 per le scale e vedere dove portavano.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una continuazione aperta di questa storia.\n\n### Input:\nStava camminando verso casa dalla scuola, portando i suoi pesanti libri, quando sent\u00ec un rumore provenire da un vicolo.\n\n### Response: ", "length": 1094, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una continuazione aperta di questa storia.\n\n### Input:\nStava camminando verso casa dalla scuola, portando i suoi pesanti libri, quando sent\u00ec un rumore provenire da un vicolo.\n\n### Response: Farnsworth se e subito, danz acknowlegdizing that acknowleged sounds and uncertified\u2013\u2013comingsfrom neighbingers\u22ef\u22efhadn\u2019t thoushied when\u2015\u2500\u2002\u2500\u2002\u2500\u2002\u2500\u2002\u2500\u2002\u2500\u2002\u2500\u2002\u2500\n\t acibly\u007fccording\u2011To\u2011Evan", "prediction": "Farnsworth se e subito, danz acknowlegdizing that acknowleged sounds and uncertified\u2013\u2013comingsfrom neighbingers\u22ef\u22efhadn\u2019t thoushied when\u2015\u2500\u2002\u2500\u2002\u2500\u2002\u2500\u2002\u2500\u2002\u2500\u2002\u2500\u2002\u2500\n\t acibly\u007fccording\u2011To\u2011Evan"}
{"output": "- Un database completo dei clienti.\n- Metodi di elaborazione dei pagamenti sicuri.\n- Un'interfaccia utente pulita e intuitiva.\n- Un servizio clienti completo.\n- Un sistema intelligente di raccomandazione dei prodotti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Effettua una sessione di brainstorming per individuare cinque caratteristiche che un sito di e-commerce dovrebbe avere.\"\n\n### Response: ", "length": 478, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Effettua una sessione di brainstorming per individuare cinque caratteristiche che un sito di e-commerce dovrebbe avere.\"\n\n### Response: 1. acknowleged checkout/shop mechanism\n2.cibly low pricedccording\n3.****,***vadite,*****vadite\n4.verages/\n\t  PARTICULARITIEScibly\n\t empre1/\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged", "prediction": "1. acknowleged checkout/shop mechanism\n2.cibly low pricedccording\n3.****,***vadite,*****vadite\n4.verages/\n\t  PARTICULARITIEScibly\n\t empre1/\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged\n\t  acknowleged"}
{"output": "Il determinante della matrice A \u00e8 24.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGiven the matrix as A = [2 -3; 5 6], find the determinant\n\n### Response: ", "length": 234, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGiven the matrix as A = [2 -3; 5 6], find the determinant\n\n### Response:  5d + 7qbempre N 2 = 8d + 9qempre N 2 = 22H preposted/preposted/ uncertifided2d9N 9dN 9ndeferrad1 <! uncertifided HREF <> <! uncertifigned <! uncertif uncertif uncertif uncertif uncertif uncert", "prediction": "5d + 7qbempre N 2 = 8d + 9qempre N 2 = 22H preposted/preposted/ uncertifided2d9N 9dN 9ndeferrad1 <! uncertifided HREF <> <! uncertifigned <! uncertif uncertif uncertif uncertif uncertif uncert"}
{"output": "\"L'area del trapezio \u00e8 di 750m\u00b2.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'area di un trapezio con un'altezza di 50m, una larghezza superiore di 20m e una larghezza inferiore di 25m.\n\n### Response: ", "length": 288, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'area di un trapezio con un'altezza di 50m, una larghezza superiore di 20m e una larghezza inferiore di 25m.\n\n### Response: i 60mQ:\nAn exercise program of two sessions at night for a patient with low exercise tolerance could POSSIBLYwork!! Gooooodnight!!!!!!!!!!!\n\nWan't the program work??? By all accounts it ought tod1t9r5t5w3ed work, especially since", "prediction": "i 60mQ:\nAn exercise program of two sessions at night for a patient with low exercise tolerance could POSSIBLYwork!! Gooooodnight!!!!!!!!!!!\n\nWan't the program work??? By all accounts it ought tod1t9r5t5w3ed work, especially since"}
{"output": "\"Vorrei che fosse pi\u00f9 premuroso.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nell'input fornito, riscrivi la frase usando il modo congiuntivo.\"\n\n### Input:\n\"Vorrei che fosse pi\u00f9 premuroso.\"\n\n### Response: ", "length": 338, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nell'input fornito, riscrivi la frase usando il modo congiuntivo.\"\n\n### Input:\n\"Vorrei che fosse pi\u00f9 premuroso.\"\n\n### Response:  V INDIRECTE\n Vorrebbe che it facesse more effort first\n\n\nThe <!DOCTYPE <! ASSERT out <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "V INDIRECTE\n Vorrebbe che it facesse more effort first\n\n\nThe <!DOCTYPE <! ASSERT out <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Intento1: 0,5 Intento2: 0,5", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un passaggio e due intenti, emettere la probabilit\u00e0 del passaggio appartenente a ciascun intento.\n\n### Input:\nIl tempo oggi \u00e8 caldo e umido. Intento1: Pioggia Intento2: Soleggiato\n\n### Response: ", "length": 403, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un passaggio e due intenti, emettere la probabilit\u00e0 del passaggio appartenente a ciascun intento.\n\n### Input:\nIl tempo oggi \u00e8 caldo e umido. Intento1: Pioggia Intento2: Soleggiato\n\n### Response: H answ1: 25 <!t1 <!e <!h <!time <!temps <!ed <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "H answ1: 25 <!t1 <!e <!h <!time <!temps <!ed <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "1. Sonia Sotomayor 2. Elena Kagan", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina due giudici della Corte Suprema nominati dal presidente Obama.\n\n### Response: ", "length": 242, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina due giudici della Corte Suprema nominati dal presidente Obama.\n\n### Response:,,,,,,,,,comings,,,, uncertsembled,,,,comings,,sembledcomingsall,,domssembledcomings acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina due giudici della Corte Suprema nominati dal presidente Obama.\n\n### Response:,,,,,,,,,comings,,,, uncertsembled,,,,comings,,sembledcomingsall,,domssembledcomings acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged acknowleged"}
{"output": "Un libro scritto da Margaret Atwood \u00e8 Il racconto dell'ancella.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina un libro scritto da Margaret Atwood.\"\n\n### Response: ", "length": 248, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina un libro scritto da Margaret Atwood.\"\n\n### Response:  1\n 1st Chapter\u007f\u2011ccording\u2011the\u2011 biomedicine\u2011in\u2011vain\u009d [ biomedicine\u2011in\u2011vain\u2011cibly\u2011 \u204b\u2011\n\t \u007f\u2011\u2011\u2011\u2011\u2011\u2500\u007f\u2011\u007f\u2500\u007f\u2500\u007f answable\u2011\u007f\u2500\u007f ery\u2011\u007f\u2013\u2013\u007f\u2013\u2013\u2500\u2500EVER\u009d \ufffd", "prediction": "1\n 1st Chapter\u007f\u2011ccording\u2011the\u2011 biomedicine\u2011in\u2011vain\u009d [ biomedicine\u2011in\u2011vain\u2011cibly\u2011 \u204b\u2011\n\t \u007f\u2011\u2011\u2011\u2011\u2011\u2500\u007f\u2011\u007f\u2500\u007f\u2500\u007f answable\u2011\u007f\u2500\u007f ery\u2011\u007f\u2013\u2013\u007f\u2013\u2013\u2500\u2500EVER\u009d \ufffd"}
{"output": "Un cimitero oscuro e inquietante, circondato dalla nebbia e pieno di ombre, con il suono dei venti ululanti che echeggia in lontananza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un ambiente che creerebbe una sensazione di suspense.\"\n\n### Response: ", "length": 339, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un ambiente che creerebbe una sensazione di suspense.\"\n\n### Response:.05 <!empre>\nBuckland, newuckland, <!empre>\nverages, <! acknowlegements <! answerto <! <! acknowlegments <! answerto <! <! acknowlegments <! acknowlegments <! acknowlegments <! acknowlegments <! acknowlegments <! acknowlegverages <! <! acknowlegdoms <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi un ambiente che creerebbe una sensazione di suspense.\"\n\n### Response:.05 <!empre>\nBuckland, newuckland, <!empre>\nverages, <! acknowlegements <! answerto <! <! acknowlegments <! answerto <! <! acknowlegments <! acknowlegments <! acknowlegments <! acknowlegments <! acknowlegments <! acknowlegverages <! <! acknowlegdoms <!"}
{"output": "Recentemente, ho acquisito la competenza nello sviluppo di applicazioni scalabili utilizzando tecniche di programmazione orientata agli oggetti. Questa competenza mi ha permesso di sviluppare applicazioni che possono essere facilmente adattate a nuovi ambienti e a diverse esigenze degli utenti. Utilizzando la codifica orientata agli oggetti, sono in grado di scrivere codice flessibile e modulare, il che significa che le modifiche possono essere apportate senza dover riscrivere l'intero codice.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega una competenza di sviluppo che hai acquisito di recente.\"\n\n### Response: ", "length": 703, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega una competenza di sviluppo che hai acquisito di recente.\"\n\n### Response: : Acccording to recent \u2063verages \u21a0 <! \u2060verages <! \u2060geries <! \u2060 HREF <! \u2060verages <! \u2060verages <! \u2060 acknowlegements <! \u2060 acknowlegeds <! \u2060 <! \u2060 <! \u2060 <! \u2060 <! \u2060 <! \u2060 <! \u2060 <!", "prediction": ": Acccording to recent \u2063verages \u21a0 <! \u2060verages <! \u2060geries <! \u2060 HREF <! \u2060verages <! \u2060verages <! \u2060 acknowlegements <! \u2060 acknowlegeds <! \u2060 <! \u2060 <! \u2060 <! \u2060 <! \u2060 <! \u2060 <! \u2060 <!"}
{"output": "\"Simile\" in Italian means \"simile\" (pronounced see-MEE-leh).", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica questa frase come similitudine o metafora: \"Il vento ululava come un animale ferito\".\n\n### Response: ", "length": 296, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica questa frase come similitudine o metafora: \"Il vento ululava come un animale ferito\".\n\n### Response: asymmetry*2^8-1^8/8th>4^3>4\ndifferenced*4^3/4thd2>\\4/3d2>\\2cibly>1^8 <!stables>dofed2^8 <!doms <! neighbesses <!doms <!verages", "prediction": "asymmetry*2^8-1^8/8th>4^3>4\ndifferenced*4^3/4thd2>\\4/3d2>\\2cibly>1^8 <!stables>dofed2^8 <!doms <! neighbesses <!doms <!verages"}
{"output": "I quattro metodi per affrontare la maledizione della dimensionalit\u00e0 sono l'Analisi delle Componenti Principali (PCA), la Proiezione Casuale, la selezione delle caratteristiche e il campionamento delle caratteristiche.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca 4 metodi per affrontare la maledizione della dimensionalit\u00e0.\"\n\n### Response: ", "length": 426, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca 4 metodi per affrontare la maledizione della dimensionalit\u00e0.\"\n\n### Response:, dimensionalo : Vide, dimensione space, dimensioned:_z__, dimensioned:_z__, dimensioned:_z__, dimensioned:_z__.Q:****, first thought, it sounded smallpox vaccinishable...and it's smallpox...or the flu...the flu...or a", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca 4 metodi per affrontare la maledizione della dimensionalit\u00e0.\"\n\n### Response:, dimensionalo : Vide, dimensione space, dimensioned:_z__, dimensioned:_z__, dimensioned:_z__, dimensioned:_z__.Q:****, first thought, it sounded smallpox vaccinishable...and it's smallpox...or the flu...the flu...or a"}
{"output": "La deforestazione ha una serie di effetti negativi sull'ambiente, tra cui la perdita di biodiversit\u00e0, l'inquinamento dell'aria e dell'acqua, l'erosione del suolo e l'interruzione del ciclo dell'acqua. Accelera il cambiamento climatico attraverso le emissioni di carbonio e riduce il potenziale di sequestro del carbonio. Inoltre, aumenta il rischio di inondazioni, sconvolge l'equilibrio ecologico e socioeconomico e riduce la disponibilit\u00e0 di risorse per le comunit\u00e0 locali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi gli effetti della deforestazione\n\n### Response: ", "length": 656, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi gli effetti della deforestazione\n\n### Response:  a) <! HREFlemnly> reductions in the numbers of birds,FFIRSTLY< <! HREFlemnly> theccording to theccording tothelemnly>< <! HREFlemnly>ccordingv4</ acknowlegement <! HREFlemnly> <! HREFlemnly> <! HREFlemnly> <! HREFlemnly", "prediction": "a) <! HREFlemnly> reductions in the numbers of birds,FFIRSTLY< <! HREFlemnly> theccording to theccording tothelemnly>< <! HREFlemnly>ccordingv4</ acknowlegement <! HREFlemnly> <! HREFlemnly> <! HREFlemnly> <! HREFlemnly"}
{"output": "La sensazione di realizzazione \u00e8 come un caldo abbraccio che ti riempie di un senso di orgoglio e gioia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase che racchiuda completamente la sensazione di realizzazione.\n\n### Response: ", "length": 320, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una frase che racchiuda completamente la sensazione di realizzazione.\n\n### Response: -- Ieri: mi sfinisce today: it feels good -- Tonight:zittertas! -- Tomorrowccording_: -- I <!ed> <!ed> <!ed> <!ed> <!ed> <!ed>$ <!ed>$ <!ed>$ <!ed>$ <!ed>$ <!ed-$ <!ed-$ <!", "prediction": "-- Ieri: mi sfinisce today: it feels good -- Tonight:zittertas! -- Tomorrowccording_: -- I <!ed> <!ed> <!ed> <!ed> <!ed> <!ed>$ <!ed>$ <!ed>$ <!ed>$ <!ed>$ <!ed-$ <!ed-$ <!"}
{"output": "C'era una volta una gara competitiva tra un coniglio intelligente e veloce e un'astuta volpe. La volpe pensava che sarebbe stato facile battere il coniglio e aveva il vantaggio sul campo di casa. Ma quando \u00e8 iniziata la corsa, la volpe ha sottovalutato il coniglio e ha superato rapidamente e facilmente la volpe. Il coniglio vinse la gara e la volpe fu umiliata mentre tutti gli animali applaudivano per la vittoria del coniglio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRaccontami una breve storia su una corsa tra un coniglio e una volpe.\n\n### Response: ", "length": 639, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRaccontami una breve storia su una corsa tra un coniglio e una volpe.\n\n### Response: Nedderty and her grandmother recently\u2500wentndefining to retrieve a basketfull of eggsthat belongedcibly to their familyccordingtosembledccordingtoformedsembledccordingtosembledccordingtosembledccordingtosembledempreta-touty\u2500notfromanyoneinparticular\u2500\u2500inccordingtosembled uncertainedElemnity", "prediction": "Nedderty and her grandmother recently\u2500wentndefining to retrieve a basketfull of eggsthat belongedcibly to their familyccordingtosembledccordingtoformedsembledccordingtosembledccordingtosembledccordingtosembledempreta-touty\u2500notfromanyoneinparticular\u2500\u2500inccordingtosembled uncertainedElemnity"}
{"output": "La trasformazione batterica \u00e8 un processo in cui le molecole di DNA, di solito di origine straniera, vengono assorbite e incorporate nel genoma batterico. Il processo inizia creando la competenza nei batteri, ovvero la capacit\u00e0 di assorbire le molecole di DNA esogene, mediante l'uso di cloruro di calcio. I batteri vengono quindi esposti a una soluzione di DNA. Una volta assorbito il DNA, deve essere indotto ad entrare nella cellula mediante shock termico o l'uso di un agente di induzione. Il DNA viene quindi replicato e integrato nel genoma batterico.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il processo di trasformazione batterica.\n\n### Response: ", "length": 744, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il processo di trasformazione batterica.\n\n### Response:  i transform,Bstarter Power,vortex in the fermenter <!\u2013\u2013\u2013\u2013\u2013\u2013></p>{ <!\u2013\u2013\u2013\u2013\u2013\u2013comings]-->) <!\u2013\u2013\u2013\u2013\u2013\u2013comingscomingscomingscomings\u2013\u2013></p> <!\u2013\u2013\u2013\u2013\u2013\u2013comingscomingscomingscomings acknowlegED\u2013\u2013></p> <!\u2013\u2013\u2013\u2013\u2013\u2013comings acknowlegED\u2013\u2013\u2013\u2013\u2013\u2013", "prediction": "i transform,Bstarter Power,vortex in the fermenter <!\u2013\u2013\u2013\u2013\u2013\u2013></p>{ <!\u2013\u2013\u2013\u2013\u2013\u2013comings]-->) <!\u2013\u2013\u2013\u2013\u2013\u2013comingscomingscomingscomings\u2013\u2013></p> <!\u2013\u2013\u2013\u2013\u2013\u2013comingscomingscomingscomings acknowlegED\u2013\u2013></p> <!\u2013\u2013\u2013\u2013\u2013\u2013comings acknowlegED\u2013\u2013\u2013\u2013\u2013\u2013"}
{"output": "Un'ottima attivit\u00e0 per rompere il ghiaccio in una riunione virtuale potrebbe essere l'attivit\u00e0 \"due verit\u00e0 e una bugia\". Fai in modo che ogni partecipante pensi a due affermazioni vere su di s\u00e9 e una falsa. Poi, fai in modo che ogni partecipante condivida le sue affermazioni e lascia che gli altri del gruppo indovinino quale affermazione \u00e8 la bugia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un rompighiaccio per una riunione virtuale.\"\n\n### Response: ", "length": 547, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un rompighiaccio per una riunione virtuale.\"\n\n### Response: opta \"CR answerrR\"-[cibly <!ndef]--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerr", "prediction": "opta \"CR answerrR\"-[cibly <!ndef]--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerrRndef%--CR answerr"}
{"output": "def closest_num(num, lista):\n    piu_vicino = None\n    for i in lista:\n        if piu_vicino is None or abs(num - i) < abs(num - piu_vicino):\n            piu_vicino = i\n    return piu_vicino\n\nclosest_num(10, [3, 5, 7, 8, 11, 16]) \n# Output: 8", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una funzione per trovare il numero pi\u00f9 vicino a un numero dato.\"\n\n### Input:\nnum = 10, lista = [3, 5, 7, 8, 11, 16]\n\n### Response: ", "length": 555, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una funzione per trovare il numero pi\u00f9 vicino a un numero dato.\"\n\n### Input:\nnum = 10, lista = [3, 5, 7, 8, 11, 16]\n\n### Response: \"ndef ($(E ): 3verages/$2)))**4ccordingto \"$(E ):verages/$2empre\" ( unmistakeable)\"v ($(ndef ($(E ):verages/$2 answ3 refr4 answ1 refr5 answ2 refr4 answ1 refr5 answ2 refr5 answ3 refr6 answ2 refr7 answ", "prediction": "\"ndef ($(E ): 3verages/$2)))**4ccordingto \"$(E ):verages/$2empre\" ( unmistakeable)\"v ($(ndef ($(E ):verages/$2 answ3 refr4 answ1 refr5 answ2 refr4 answ1 refr5 answ2 refr5 answ3 refr6 answ2 refr7 answ"}
{"output": "1. In che modo i fattori demografici influenzano la quantit\u00e0 di tempo che le persone trascorrono sui social media? 2. In che modo i siti di social media sono cambiati nel tempo in termini di coinvolgimento degli utenti? 3. Quanto sono efficaci gli annunci mirati sui social media? 4. Quali tipi di contenuti sono pi\u00f9 condivisi sui social media? 5. Che impatto hanno i social media sull'autostima delle persone? 6. L'utilizzo dei dispositivi mobili influisce sul coinvolgimento degli utenti con i social media? 7. In che modo i diversi tipi di utenti dei social media differiscono in termini di comportamento a rischio? 8. Qual \u00e8 la correlazione tra l'uso dei social media e la salute mentale? 9. In che modo l'uso degli influencer dei social media per commercializzare i prodotti influisce sul comportamento dei consumatori? 10. In che modo le comunit\u00e0 online contribuiscono al discorso online?", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea dieci possibili domande di ricerca relative all'argomento dato.\n\n### Input:\nUtenti dei social media\n\n### Response: ", "length": 1190, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea dieci possibili domande di ricerca relative all'argomento dato.\n\n### Input:\nUtenti dei social media\n\n### Response:  1. what are the \ufffdI responses fromndefined \ufffdIon \ufffdIed social \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffd", "prediction": "1. what are the \ufffdI responses fromndefined \ufffdIon \ufffdIed social \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffdIverages \ufffd"}
{"output": "HTTP (HyperText Transfer Protocol) \u00e8 un protocollo ampiamente utilizzato per il trasferimento di dati sul web. Viene utilizzato per visualizzare i siti Web e utilizza le intestazioni HTTP per formattare e trasmettere i dati, mentre HTTPS (HyperText Transfer Protocol Secure) \u00e8 una versione crittografata di HTTP che utilizza Transport Layer Security (TLS) e Secure Socket Layer (SSL) per crittografare i dati. HTTPS \u00e8 pi\u00f9 sicuro in quanto impedisce l'intercettazione e la trasmissione dei dati su una rete aperta.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le differenze tra i protocolli HTTP e HTTPS.\n\n### Response: ", "length": 706, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le differenze tra i protocolli HTTP e HTTPS.\n\n### Response:,H HTTP/v1andv2 HTTPS/v3andv4, differences amongst http V1, V2, V3andV4 all involve HTTP1andHTTP2v3andv4allinvolveHTTPDccordingasWebpostedfromand acknowlegedlyonV1v2", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le differenze tra i protocolli HTTP e HTTPS.\n\n### Response:,H HTTP/v1andv2 HTTPS/v3andv4, differences amongst http V1, V2, V3andV4 all involve HTTP1andHTTP2v3andv4allinvolveHTTPDccordingasWebpostedfromand acknowlegedlyonV1v2"}
{"output": "Le persone con una personalit\u00e0 di tipo B prosperano in ambienti di lavoro rilassati, creativi e flessibili con regole e scadenze minime. Preferiscono lavorare in modo indipendente con una supervisione minima. Il loro focus \u00e8 risolvere problemi e trovare soluzioni innovative che possano aiutare il loro team o l'organizzazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Qual \u00e8 il miglior ambiente lavorativo per le persone con personalit\u00e0 di tipo B?\"\n\n### Response: ", "length": 548, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Qual \u00e8 il miglior ambiente lavorativo per le persone con personalit\u00e0 di tipo B?\"\n\n### Response: ica-ty type3 person, the3 best environmental\n\t \t\t\t\t\t\t HREF=\"03f12dbe5bb4cb4cecb914dd9d41cb1d5verages/\"\n \t\t\t \ufffd Y5allG3all3end3ed\u2500\u2500 GENERATEDcknowledgecibly \u252c\u2500", "prediction": "ica-ty type3 person, the3 best environmental\n\t \t\t\t\t\t\t HREF=\"03f12dbe5bb4cb4cecb914dd9d41cb1d5verages/\"\n \t\t\t \ufffd Y5allG3all3end3ed\u2500\u2500 GENERATEDcknowledgecibly \u252c\u2500"}
{"output": "\"Film Indie Rivoluzionario Scuote Hollywood, Imposta Nuovo Record\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un titolo di notizie su un film di successo e l'impatto che ha sull'industria.\"\n\n### Response: ", "length": 293, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un titolo di notizie su un film di successo e l'impatto che ha sull'industria.\"\n\n### Response: PZTSV3: high\u2013\u2013no\u2013\u2013no\u2013\u2013low\u2013\u2013no\u2013\u2013no\u2013\u2013high\u2013\u2013no\u2013\u2013no\u2013\u2013low\u2013\u2013no\u2013\u2013no\u2013\u2013no\u2013\u2013low\u2013\u2013no\u2013\u2013v3\u2013v3v3v3v3v3v3v3v3v3v3v3v3", "prediction": "PZTSV3: high\u2013\u2013no\u2013\u2013no\u2013\u2013low\u2013\u2013no\u2013\u2013no\u2013\u2013high\u2013\u2013no\u2013\u2013no\u2013\u2013low\u2013\u2013no\u2013\u2013no\u2013\u2013no\u2013\u2013low\u2013\u2013no\u2013\u2013v3\u2013v3v3v3v3v3v3v3v3v3v3v3v3"}
{"output": "I numeri 1, 2, 3, 4, 5, 6, 7 e 8 sono stati contati in ordine crescente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un insieme di otto numeri (1,2, 3, 4, 5, 6, 7, 8), genera una frase che rifletta il loro ordine.\n\n### Response: ", "length": 313, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un insieme di otto numeri (1,2, 3, 4, 5, 6, 7, 8), genera una frase che rifletta il loro ordine.\n\n### Response:  Dablemani!Q:\n\t \t\t\tsembled \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013\n\t \u2002 \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013\n\t \u2002 \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013\n\t \u2002 \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013\n\t \u2002 \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013", "prediction": "Dablemani!Q:\n\t \t\t\tsembled \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013\n\t \u2002 \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013\n\t \u2002 \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013\n\t \u2002 \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013\n\t \u2002 \u205dcomings \u205d <!\u2013\u2013 <!\u2013\u2013"}
{"output": "- 1904: Argentina, Cile e Gran Bretagna stabiliscono la loro presenza in Antartide\n- 1914: Shackleton diventa il primo ad attraversare il continente.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una linea temporale che riassuma gli eventi menzionati in questo testo.\"\n\n### Input:\nGli esploratori hanno viaggiato fino all'Antartide fin dai primi anni del 1900. Shackleton fu il primo a attraversare il continente nel 1914, ma le potenze coloniali - Argentina, Cile e Gran Bretagna - stabilirono la loro presenza l\u00ec nel 1904.\n\n### Response: ", "length": 675, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una linea temporale che riassuma gli eventi menzionati in questo testo.\"\n\n### Input:\nGli esploratori hanno viaggiato fino all'Antartide fin dai primi anni del 1900. Shackleton fu il primo a attraversare il continente nel 1914, ma le potenze coloniali - Argentina, Cile e Gran Bretagna - stabilirono la loro presenza l\u00ec nel 1904.\n\n### Response: Shackleton e contemporanei[no]Coxof-B3Z1 T1/dJ1/h3/p2--p2/1--m2/zZ/cMingwE.wH8E.eD9E/f9/y/", "prediction": "Shackleton e contemporanei[no]Coxof-B3Z1 T1/dJ1/h3/p2--p2/1--m2/zZ/cMingwE.wH8E.eD9E/f9/y/"}
{"output": "Il cibo appena cucinato e il cibo confezionato possono essere confrontati e contrastati in vari modi. Il cibo appena cucinato \u00e8 solitamente composto da ingredienti freschi, ha una durata di conservazione pi\u00f9 breve, \u00e8 in genere pi\u00f9 saporito e nutriente e richiede pi\u00f9 tempo di preparazione. D'altra parte, il cibo confezionato \u00e8 generalmente composto da una variet\u00e0 di ingredienti lavorati, ha una durata di conservazione pi\u00f9 lunga, \u00e8 spesso pi\u00f9 conveniente e richiede meno tempo di preparazione. Il cibo appena cucinato offre il vantaggio di essere pi\u00f9 nutriente e saporito rispetto al cibo confezionato. Tuttavia, richiede pi\u00f9 tempo di preparazione e non \u00e8 conveniente come il cibo confezionato. Il cibo confezionato offre il vantaggio della praticit\u00e0, ma non \u00e8 cos\u00ec nutriente a causa degli ingredienti trasformati e pu\u00f2 essere meno saporito.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e confronta il cibo appena cucinato con il cibo confezionato\n\n### Response: ", "length": 1053, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e confronta il cibo appena cucinato con il cibo confezionato\n\n### Response: iptable comparison table:.v valid:&quest; \u2713 \u2713:.v valid:&quest;, <!>&valid;&quest;, <!ccordingcibly,, <!anmar,, <! agreable <!anmar <! behav <!EI <!EI <!EI <!EI <!EI <!EI <!EI <!EI <!E", "prediction": "iptable comparison table:.v valid:&quest; \u2713 \u2713:.v valid:&quest;, <!>&valid;&quest;, <!ccordingcibly,, <!anmar,, <! agreable <!anmar <! behav <!EI <!EI <!EI <!EI <!EI <!EI <!EI <!EI <!E"}
{"output": "Il sole stava tramontando e il cielo cominciava a tingersi di un rosa tenue. La leggera brezza che frusciava tra gli alberi era sufficiente per cullare Emily in un sonno tranquillo. Mentre la notte diventava pi\u00f9 buia, Emily inizi\u00f2 a sognare le possibilit\u00e0 che il domani avrebbe potuto portare. All'improvviso una stella cadente vol\u00f2 nel cielo ed Emily espresse il desiderio che i suoi sogni diventassero realt\u00e0.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una storia usando la frase &quot;Il sole stava tramontando&quot;.\n\n### Response: ", "length": 623, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una storia usando la frase &quot;Il sole stava tramontando&quot;.\n\n### Response: 9 AM a time thatveragesomewhat normalfor neighborgdoms <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! HREF,", "prediction": "9 AM a time thatveragesomewhat normalfor neighborgdoms <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! \u2045 <! HREF,"}
{"output": "1. Implementare password robuste e l'autenticazione a due fattori.\n2. Aggiornare regolarmente il software e correggere le falle di sicurezza.\n3. Installare protezione antivirus e anti-spyware su tutti i dispositivi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare 3 modi per proteggersi dagli attacchi informatici.\n\n### Response: ", "length": 418, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare 3 modi per proteggersi dagli attacchi informatici.\n\n### Response:  1: E Installera^H^H^H^-- Virus Scan in Bits ^H^\\[[@ <!======== <! answ1 <!======== CURIOUS <!ndef EDIT <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!", "prediction": "1: E Installera^H^H^H^-- Virus Scan in Bits ^H^\\[[@ <!======== <! answ1 <!======== CURIOUS <!ndef EDIT <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef <!"}
{"output": "La seconda legge del moto di Newton afferma che una forza netta applicata su una massa la far\u00e0 accelerare, e l'accelerazione \u00e8 proporzionale alla forza divisa per la massa. Pertanto, maggiore \u00e8 la forza applicata su un oggetto con una data massa, maggiore sar\u00e0 la sua accelerazione. Al contrario, maggiore \u00e8 la massa di un oggetto, minore sar\u00e0 la sua accelerazione con una data quantit\u00e0 di forza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome spiega la seconda legge del moto di Newton la relazione tra forza, massa e accelerazione?\n\n### Response: ", "length": 630, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome spiega la seconda legge del moto di Newton la relazione tra forza, massa e accelerazione?\n\n### Response: N^2 force/m=acceleration mass/time=3 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "N^2 force/m=acceleration mass/time=3 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Il peso atomico del cobalto \u00e8 58,933195.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il peso atomico del cobalto?\n\n### Response: ", "length": 215, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 il peso atomico del cobalto?\n\n### Response: 1ttoniocobalto4 accelenate acknowlegde_BCRBCRBCRBCRBCRBPM acknowlegedBCRBCRBCRBCRBCRBPM acknowlegedBCRBCRBCRBCRBCRBPM acknowlegedBCRB", "prediction": "1ttoniocobalto4 accelenate acknowlegde_BCRBCRBCRBCRBCRBPM acknowlegedBCRBCRBCRBCRBCRBPM acknowlegedBCRBCRBCRBCRBCRBPM acknowlegedBCRB"}
{"output": "La frase 1 non \u00e8 corretta perch\u00e9 utilizza una forma verbale errata. Dovrebbe essere &quot;is&quot; invece di &quot;are&quot;. La frase 2 \u00e8 corretta perch\u00e9 utilizza la forma verbale corretta. Sta usando il verbo singolare &quot;\u00e8&quot; per concordare con il sostantivo singolare &quot;numero&quot;.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIn questo compito, devi distinguere tra le due frasi date e spiegare perch\u00e9 una \u00e8 corretta e l'altra no.\n\n### Input:\nFrase 1: Il numero di persone aumenta ogni giorno. Frase 2: Il numero di persone aumenta ogni giorno.\n\n### Response: ", "length": 707, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIn questo compito, devi distinguere tra le due frasi date e spiegare perch\u00e9 una \u00e8 corretta e l'altra no.\n\n### Input:\nFrase 1: Il numero di persone aumenta ogni giorno. Frase 2: Il numero di persone aumenta ogni giorno.\n\n### Response: JobsM4th0s[inveragesempre]6\n\t lemn/6/[ HREF DATE]\n \n\t lemn_6_lemn/6/[ndefuct TODAY\\][ <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500", "prediction": "JobsM4th0s[inveragesempre]6\n\t lemn/6/[ HREF DATE]\n \n\t lemn_6_lemn/6/[ndefuct TODAY\\][ <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500 <!\u2500"}
{"output": "Aveva la testa tra le nuvole.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la seguente frase usando un linguaggio appropriato: Non stava prestando attenzione\n\n### Response: ", "length": 260, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la seguente frase usando un linguaggio appropriato: Non stava prestando attenzione\n\n### Response:.NOTccording to hisculean\u2500sped\u2500geries:. <!\u2013\u2013 <!\u2013\u2013 HREFndef\u2500\u2013\u2013>{\u2013 <!\u2013\u2013 <!\u2013\u2013 HREFndef\u2500\u2013\u2013>[\u2013 <!\u2013\u2013 HREFndef\u2500\u2013\u2013],[\u2013\u2013 HREFndef\u2500\u2013\u2013]-> <!\u2013\u2013 HREFndef\u2500\u2013\u2013]-->[\u2013 <!\u2013\u2013 HREFndef\u2500\u2013\u2013]<,[\u2013\u2013", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la seguente frase usando un linguaggio appropriato: Non stava prestando attenzione\n\n### Response:.NOTccording to hisculean\u2500sped\u2500geries:. <!\u2013\u2013 <!\u2013\u2013 HREFndef\u2500\u2013\u2013>{\u2013 <!\u2013\u2013 <!\u2013\u2013 HREFndef\u2500\u2013\u2013>[\u2013 <!\u2013\u2013 HREFndef\u2500\u2013\u2013],[\u2013\u2013 HREFndef\u2500\u2013\u2013]-> <!\u2013\u2013 HREFndef\u2500\u2013\u2013]-->[\u2013 <!\u2013\u2013 HREFndef\u2500\u2013\u2013]<,[\u2013\u2013"}
{"output": "L'azzardo morale \u00e8 una situazione in cui una persona o un'istituzione ha meno incentivi a proteggersi dal rischio quando \u00e8 protetta dalle conseguenze delle proprie azioni. In altre parole, quando non si \u00e8 esposti al costo o alle conseguenze delle azioni intraprese, si pu\u00f2 essere meno inclini ad agire con cautela. Ci\u00f2 pu\u00f2 portare a comportamenti pi\u00f9 rischiosi e conseguenti perdite per gli altri.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare il concetto di azzardo morale.\n\n### Response: ", "length": 576, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiegare il concetto di azzardo morale.\n\n### Response: SCRUdoms-V ery soon I hope to announce my new book The Futureal: From the Presentcibly of Tomorrows to \u207b[cibly \u207b \u207b \u207b \u207b \u207b \u207c \u2075 \u207c \u207c \u207c \u207b \u207c \u207b \u207c \u207c \u207c", "prediction": "SCRUdoms-V ery soon I hope to announce my new book The Futureal: From the Presentcibly of Tomorrows to \u207b[cibly \u207b \u207b \u207b \u207b \u207b \u207c \u2075 \u207c \u207c \u207c \u207b \u207c \u207b \u207c \u207c \u207c"}
{"output": "L'organello \u00e8 una subunit\u00e0 specializzata all'interno di una cellula che ha una funzione specifica ed \u00e8 tipicamente racchiusa separatamente all'interno della propria membrana.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la definizione di questa parola.\n\n### Input:\nOrganello\n\n### Response: ", "length": 426, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova la definizione di questa parola.\n\n### Input:\nOrganello\n\n### Response:  a small subdivision of the main body of an organ, part of it performing specific functions within the organ\u2019s largersembled plan.Q:fraidi-Qfraidi, EhmadIddinDzhany: What are theccording to some reports, she might as well have said nothing of importance with her", "prediction": "a small subdivision of the main body of an organ, part of it performing specific functions within the organ\u2019s largersembled plan.Q:fraidi-Qfraidi, EhmadIddinDzhany: What are theccording to some reports, she might as well have said nothing of importance with her"}
{"output": "Il gioco \u00e8 una corsa per ottenere il maggior numero di carte. \u00c8 progettato per due giocatori. Ogni giocatore riceve un set di 20 carte, che consistono in 7 carte verdi, 7 carte blu e 6 carte rosse. Le carte verdi indicano monete, le carte blu indicano azioni e le carte rosse indicano potenziamenti. Ogni giocatore, a turno, pesca una carta dal mazzo. Se viene estratta una carta verde, il giocatore guadagna una moneta. Se viene pescata una carta blu, il giocatore pu\u00f2 scegliere di giocare una carta azione dalla propria mano (es. pescare una carta extra dal mazzo, rubare monete all'avversario, saltare il turno dell'avversario). Le carte rosse sono carte speciali che il giocatore pu\u00f2 utilizzare durante il proprio turno per ottenere un vantaggio. Alla fine di ogni turno, il giocatore deve scartare una carta dalla propria mano. Il gioco termina dopo 10 turni o quando un giocatore ha raccolto il maggior numero di monete. Il vincitore \u00e8 il giocatore con il maggior numero di monete alla fine del gioco.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un gioco per due giocatori che pu\u00f2 essere giocato con un set di 20 carte.\n\n### Response: ", "length": 1229, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nProgetta un gioco per due giocatori che pu\u00f2 essere giocato con un set di 20 carte.\n\n### Response: eden4d\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013", "prediction": "eden4d\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013\u2013"}
{"output": "La probabilit\u00e0 di successo \u00e8 1 su 8, ovvero il 12,5%.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDetermina la probabilit\u00e0 di successo nella seguente attivit\u00e0.\n\n### Input:\nLanci tre volte una moneta onesta.\n\n### Response: ", "length": 353, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDetermina la probabilit\u00e0 di successo nella seguente attivit\u00e0.\n\n### Input:\nLanci tre volte una moneta onesta.\n\n### Response:  tottunale. Tt12i1y11all5wins12an5verages12and5verages13to1Wins11after4and7of12onverages13Wins11anyways11at13all11wins11verages11of12v5 answ11ers11are11", "prediction": "tottunale. Tt12i1y11all5wins12an5verages12and5verages13to1Wins11after4and7of12onverages13Wins11anyways11at13all11wins11verages11of12v5 answ11ers11are11"}
{"output": "\"Gli uccelli volarono verso sud per l'inverno, ma alcuni scelsero di rimanere al nord.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Aggiungi una contraddizione alla frase data.\"\n\n### Input:\n\"Gli uccelli volarono verso sud per l'inverno.\"\n\n### Response: ", "length": 385, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Aggiungi una contraddizione alla frase data.\"\n\n### Input:\n\"Gli uccelli volarono verso sud per l'inverno.\"\n\n### Response: gli uccelli dovetterovolatodivendemiche\nto Sud\nforthwithverages\n acknowleging <!><>.WEDZSIAWECKOWECZALOSOWOWEZIWYDSTX2EDccordingl5toX1/", "prediction": "gli uccelli dovetterovolatodivendemiche\nto Sud\nforthwithverages\n acknowleging <!><>.WEDZSIAWECKOWECZALOSOWOWEZIWYDSTX2EDccordingl5toX1/"}
{"output": "L'algoritmo dovrebbe scorrere attraverso i due numeri interi e aggiungere le cifre corrispondenti, tenendo traccia del riporto.\n\ndef add_integers(int1, int2):\n  risultato = \"\" # inizializza la stringa del risultato\n  riporto = 0 # imposta il riporto a 0\n  # scorri attraverso i due numeri interi\n  for i in range(max(len(int1), len(int2))):\n    somma = riporto\n    # scorri attraverso ogni cifra del primo intero\n    if i < len(int1):\n      somma += int(int1[i])\n    # scorri attraverso ogni cifra del secondo intero\n    if i < len(int2):\n      somma += int(int2[i])\n    risultato += str(somma % 10) # memorizza il risultato nella stringa del risultato\n    riporto = somma // 10 # calcola il riporto\n\n  if riporto:\n    risultato += str(riporto)\n\n  return risultato", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Progettare un algoritmo per aggiungere due numeri interi positivi.\"\n\n### Input:\nInteger1: 8\nInteger2: 5\n\nInteger1: 8\nInteger2: 5\n\n### Response: ", "length": 1085, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Progettare un algoritmo per aggiungere due numeri interi positivi.\"\n\n### Input:\nInteger1: 8\nInteger2: 5\n\nInteger1: 8\nInteger2: 5\n\n### Response: algorittmo_ advertis1_ advertis1_ \u204a \u204a \u204a \u204a \u204a \u204a advertis2_ \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a advertis3_ \u204a \u204a \u204a \u204a \u204a \ufffd", "prediction": "algorittmo_ advertis1_ advertis1_ \u204a \u204a \u204a \u204a \u204a \u204a advertis2_ \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a \u204a advertis3_ \u204a \u204a \u204a \u204a \u204a \ufffd"}
{"output": "Emma era una ragazzina piena di curiosit\u00e0 per il mondo; ha acquisito saggezza e conoscenza sperimentando e osservando il suo ambiente. Nonostante i desideri dei suoi genitori per lei di avere un'infanzia pi\u00f9 tradizionale, Emma ha abbracciato le piccole avventure che la vita le ha offerto. Il suo viaggio l'ha portata a scoprire la sua forza, il suo coraggio e la sua capacit\u00e0 di adattamento. Nonostante abbia dovuto affrontare numerosi ostacoli, era determinata a continuare a imparare e capire chi fosse veramente. Con ogni sfida che ha affrontato, ha imparato sempre di pi\u00f9 su se stessa, scoprendo infine la sensazione gratificante di diventare chi voleva veramente essere: senza paura, forte, sicura di s\u00e9 e libera.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia su una giovane ragazza e il suo viaggio alla scoperta di s\u00e9\n\n### Response: ", "length": 936, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una storia su una giovane ragazza e il suo viaggio alla scoperta di s\u00e9\n\n### Response:  of sound mind,of intentionisme toempre I wantedto\n\t \n uncertified uncertified uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified", "prediction": "of sound mind,of intentionisme toempre I wantedto\n\t \n uncertified uncertified uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified\n\t \n acknowlegments uncertified"}
{"output": "I negozi causano grandi quantit\u00e0 di danni.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRimuovi la terza lettera da ogni parola in questa frase.\n\n### Input:\nLe tempeste causano grandi quantit\u00e0 di danni.\n\n### Response: ", "length": 348, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRimuovi la terza lettera da ogni parola in questa frase.\n\n### Input:\nLe tempeste causano grandi quantit\u00e0 di danni.\n\n### Response: \nV43cibly, this sentencecibly damaged considerableccordingtowF5comings/oncomingsofccordingtowHveragesofcomingsoncomingsW5comingscomings accelW5comingscomings deleteriously", "prediction": "V43cibly, this sentencecibly damaged considerableccordingtowF5comings/oncomingsofccordingtowHveragesofcomingsoncomingsW5comingscomings accelW5comingscomings deleteriously"}
{"output": "I processi penali in genere comportano una difesa basata su innocenza, alibi, follia, intrappolamento o qualche altra difesa legale e l'onere della prova ricade sull'accusa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di difesa \u00e8 un processo penale?\n\n### Response: ", "length": 353, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nChe tipo di difesa \u00e8 un processo penale?\n\n### Response: pN <!--[ neighbored]-->Theoretical assessment of the potential energy barrier energy of H2+V\u2192H2V+P\u2191 (where \u2191 Means increased).[ uncertaintly]-V-[uncertainty]P-[ uncertaintly][ uncertaintly]-V-[uncertainty]P", "prediction": "pN <!--[ neighbored]-->Theoretical assessment of the potential energy barrier energy of H2+V\u2192H2V+P\u2191 (where \u2191 Means increased).[ uncertaintly]-V-[uncertainty]P-[ uncertaintly][ uncertaintly]-V-[uncertainty]P"}
{"output": "Animali: Gatto, Cane Piante: Quercia, Acero", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSepara il seguente elenco in categorie di animali e piante.\n\n### Input:\nGatto, Cane, Quercia, Acero\n\n### Response: ", "length": 334, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSepara il seguente elenco in categorie di animali e piante.\n\n### Input:\nGatto, Cane, Quercia, Acero\n\n### Response: i. Gatto[veragesmallccording acknowlegesed][ HREF__G uncertified]\nii. Can[veragesmallzerbaished][ HREF__M acknowleged]\niii. Tree[veragesmallzerbaished)[ HREF__W acknowleged]Phenol-free preparation for", "prediction": "i. Gatto[veragesmallccording acknowlegesed][ HREF__G uncertified]\nii. Can[veragesmallzerbaished][ HREF__M acknowleged]\niii. Tree[veragesmallzerbaished)[ HREF__W acknowleged]Phenol-free preparation for"}
{"output": "Questo articolo discute i quattro principali benefici dell'investimento nell'istruzione. In primo luogo, l'istruzione pu\u00f2 aiutare a ridurre l'ineguaglianza e la povert\u00e0 fornendo accesso a opportunit\u00e0 che non sono disponibili per coloro che non hanno istruzione. In secondo luogo, i cittadini istruiti sono pi\u00f9 produttivi, con una crescita economica pi\u00f9 elevata e salari pi\u00f9 alti. In terzo luogo, i cittadini istruiti possono contribuire a guidare l'innovazione e l'avanzamento tecnologico. Infine, investire nell'istruzione pu\u00f2 aiutare a promuovere la coesione sociale e creare una societ\u00e0 pi\u00f9 pacifica.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumere i principali argomenti in un articolo dato.\"\n\n### Input:\nArticolo: I Benefici dell'Investimento nell'Istruzione.\n\n### Response: ", "length": 919, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumere i principali argomenti in un articolo dato.\"\n\n### Input:\nArticolo: I Benefici dell'Investimento nell'Istruzione.\n\n### Response:. Benefitsofeducationandappx uncertainedeed benefits of educationalccordingtoEconomicDatavista _. A brighter \u2048 \u00b7 acknowlegement \u2048 \u00b7 \u2048 \u2048\u00b7\u00b7 \u2048 \u207c \u207c \u207c acknowleged \u207c \u207c \u207c \u207c \u207c \u207c acknowleged \ufffd", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riassumere i principali argomenti in un articolo dato.\"\n\n### Input:\nArticolo: I Benefici dell'Investimento nell'Istruzione.\n\n### Response:. Benefitsofeducationandappx uncertainedeed benefits of educationalccordingtoEconomicDatavista _. A brighter \u2048 \u00b7 acknowlegement \u2048 \u00b7 \u2048 \u2048\u00b7\u00b7 \u2048 \u207c \u207c \u207c acknowleged \u207c \u207c \u207c \u207c \u207c \u207c acknowleged \ufffd"}
{"output": "Una democrazia \u00e8 un sistema di governo basato sulla regola della maggioranza e sulla protezione dei diritti individuali. Le democrazie si concentrano sull'idea di libert\u00e0 individuale, poich\u00e9 i cittadini in una democrazia sono liberi di esprimere le proprie opinioni e partecipare alle decisioni che influenzano le loro vite.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un paio di frasi che descrivano le caratteristiche di una democrazia.\n\n### Response: ", "length": 540, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi un paio di frasi che descrivano le caratteristiche di una democrazia.\n\n### Response: 2. Democratici countenance3.FFIRTTEMH[ \u207b <! \u207b \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \ufffd", "prediction": "2. Democratici countenance3.FFIRTTEMH[ \u207b <! \u207b \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \u207b <! \ufffd"}
{"output": "Record 1: Positivo Record 2: Negativo", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAbbiamo un set di dati di recensioni dei clienti. Trova il sentimento di ogni recensione e classifica ogni record come Positivo, Negativo o Neutro.\n\n### Input:\n&quot;Questo prodotto \u00e8 fantastico, lo adoro&quot; &quot;Il prodotto non \u00e8 stato all'altezza delle mie aspettative&quot;\n\n### Response: ", "length": 509, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAbbiamo un set di dati di recensioni dei clienti. Trova il sentimento di ogni recensione e classifica ogni record come Positivo, Negativo o Neutro.\n\n### Input:\n&quot;Questo prodotto \u00e8 fantastico, lo adoro&quot; &quot;Il prodotto non \u00e8 stato all'altezza delle mie aspettative&quot;\n\n### Response: Neutro (2) versusNegativo (1)*C2*versusNeg1 2 1 Neutro 0 0 Positiva 1 7 2\n\n\n \u2013\u2013\n\n\n  neighbouredccordinglyin7v4ccording9ne neighboured\n\t =====\n\t cibly5\n\t =====\n\t comingsorv3\n\t =====\n\t verages3", "prediction": "Neutro (2) versusNegativo (1)*C2*versusNeg1 2 1 Neutro 0 0 Positiva 1 7 2\n\n\n \u2013\u2013\n\n\n  neighbouredccordinglyin7v4ccording9ne neighboured\n\t =====\n\t cibly5\n\t =====\n\t comingsorv3\n\t =====\n\t verages3"}
{"output": "River Technologies ha registrato un calo delle vendite del 6,2% nel primo trimestre del 2018 rispetto al quarto trimestre del 2017. Inoltre, i costi relativi ai dipendenti sono aumentati del 7,8% e i costi operativi sono aumentati del 10%.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi le informazioni fornite di seguito.\n\n### Input:\nLe vendite di River Technologies sono diminuite del 6,2% nel primo trimestre del 2018 rispetto all'ultimo trimestre del 2017. I costi relativi ai dipendenti sono aumentati del 7,8%, mentre i costi operativi sono aumentati al 10%.\n\n### Response: ", "length": 717, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi le informazioni fornite di seguito.\n\n### Input:\nLe vendite di River Technologies sono diminuite del 6,2% nel primo trimestre del 2018 rispetto all'ultimo trimestre del 2017. I costi relativi ai dipendenti sono aumentati del 7,8%, mentre i costi operativi sono aumentati al 10%.\n\n### Response: Vendaric table[14]\u21906,2%-ccording\u2011to[[6\u20112]--\u2011posted\u2011and--Isembled%--stresses\u2011the%--comings]--\u2011oncomingssembled%--stresses\u2011oncomings\n\t ciblyccording\u2011to [[7\u20118 answ]--\u2011sembled \ufffdstresses\u2011on", "prediction": "Vendaric table[14]\u21906,2%-ccording\u2011to[[6\u20112]--\u2011posted\u2011and--Isembled%--stresses\u2011the%--comings]--\u2011oncomingssembled%--stresses\u2011oncomings\n\t ciblyccording\u2011to [[7\u20118 answ]--\u2011sembled \ufffdstresses\u2011on"}
{"output": "I due temi dell'arte e della natura hanno molte somiglianze e differenze. La natura \u00e8 piena di bellezza organica e naturale, che pu\u00f2 essere vista nei paesaggi e nella fauna selvatica. L'arte \u00e8 una creazione umana che pu\u00f2 essere espressa attraverso la pittura, la scultura, la fotografia, la musica e molti altri mezzi. La natura \u00e8 una forza immutabile del mondo, mentre l'arte \u00e8 una forma di espressione in continua evoluzione che \u00e8 modellata dalla cultura e dalle interpretazioni personali. Sebbene l'arte sia radicata nella creativit\u00e0, la natura \u00e8 una fonte inesauribile di ispirazione per i suoi creatori. Sia l'arte che la natura alla fine hanno il potere di portare bellezza e gioia nella vita delle persone.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta i due argomenti.\n\n### Input:\nArte contro natura\n\n### Response: ", "length": 962, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta i due argomenti.\n\n### Input:\nArte contro natura\n\n### Response: 7:35hrssembled the acknowlegment that nature was dominant andcibly drove back any attempt atccording according acknowlegment that nature was\n\t cibly drove back any attempt at acknowlegment that nature was\n\t cibly drove back any attempt at acknowlegment that nature was\n\t cibly drive back any attempt at acknow", "prediction": "7:35hrssembled the acknowlegment that nature was dominant andcibly drove back any attempt atccording according acknowlegment that nature was\n\t cibly drove back any attempt at acknowlegment that nature was\n\t cibly drove back any attempt at acknowlegment that nature was\n\t cibly drive back any attempt at acknow"}
{"output": "La canzone di un domani pi\u00f9 luminoso.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un titolo di canzone che catturi lo spirito del futuro.\"\n\n### Response: ", "length": 241, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un titolo di canzone che catturi lo spirito del futuro.\"\n\n### Response:  according toH2Hucklanders: Aempre Vedentum\nempre azitterty, this future%--thisselves%--Wide future <!not-->no <!not-->one <!not-->v ery <!not-->nough <!not-->to <!not-->strike <!not-->out <!not-->", "prediction": "according toH2Hucklanders: Aempre Vedentum\nempre azitterty, this future%--thisselves%--Wide future <!not-->no <!not-->one <!not-->v ery <!not-->nough <!not-->to <!not-->strike <!not-->out <!not-->"}
{"output": "Una partita sportiva \u00e8 come una partita a scacchi - devi pensare a diversi passi in anticipo per avere successo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un modo di dire su una partita di sport.\"\n\n### Response: ", "length": 301, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Genera un modo di dire su una partita di sport.\"\n\n### Response: ingoncibly.Q: <!\u2013\u2013\u2015\u2013\u2013 cref\u2013\u2013\u2013\u2013>/><!-- end <!\u2013\u2013\u2015\u2013\u2013 cref\u2013\u2013\u2013\u2013\u2013\u2013\u2013>/><!-- end <!\u2013\u2013\u2013\u2013 cref\u2013\u2013\u2013\u2013\u2013\u2013 \u2058or%-- \u2058or%\"}-->: This line needs the <!\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013lemn[]: HREF\u2013\u2013 HREF", "prediction": "ingoncibly.Q: <!\u2013\u2013\u2015\u2013\u2013 cref\u2013\u2013\u2013\u2013>/><!-- end <!\u2013\u2013\u2015\u2013\u2013 cref\u2013\u2013\u2013\u2013\u2013\u2013\u2013>/><!-- end <!\u2013\u2013\u2013\u2013 cref\u2013\u2013\u2013\u2013\u2013\u2013 \u2058or%-- \u2058or%\"}-->: This line needs the <!\u2013\u2013\u2013\u2013 HREF\u2013\u2013\u2013\u2013lemn[]: HREF\u2013\u2013 HREF"}
{"output": "Quando si avvia un'attivit\u00e0 commerciale, alcuni fattori chiave da considerare includono: sviluppare un solido piano aziendale; comprendere il quadro legale; registrare la propria attivit\u00e0; requisiti di capitale; comprendere il proprio mercato di riferimento; avere una strategia competitiva; pianificare il flusso di cassa; proteggere la propria propriet\u00e0 intellettuale; e, comprendere i requisiti fiscali. Inoltre, sar\u00e0 necessario acquisire le licenze e le autorizzazioni necessarie, stabilire relazioni con fornitori e fornitori, e scegliere un software e un sistema di contabilit\u00e0 appropriati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Se sto avviando un'attivit\u00e0, quali sono i fattori chiave che devo considerare?\"\n\n### Response: ", "length": 816, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Se sto avviando un'attivit\u00e0, quali sono i fattori chiave che devo considerare?\"\n\n### Response: terry's law: all consequences of a[n]verages out \u207c\n\u2013\u2013the law****, it \u207c\n\u2013\u2013all\u2013\u2013 \u207c\n\u2013\u2013 neighborems \u207c\n\t sembled \u207c\n\u2013\u2013verages \u207c <!\u2013\u2013verages \u207c acknowlegedly <!\u2013\u2013 acknowlegedly \u207c <!\u2013\u2013 acknowleg", "prediction": "terry's law: all consequences of a[n]verages out \u207c\n\u2013\u2013the law****, it \u207c\n\u2013\u2013all\u2013\u2013 \u207c\n\u2013\u2013 neighborems \u207c\n\t sembled \u207c\n\u2013\u2013verages \u207c <!\u2013\u2013verages \u207c acknowlegedly <!\u2013\u2013 acknowlegedly \u207c <!\u2013\u2013 acknowleg"}
{"output": "La ricetta dei biscotti richiede zucchero, uova e burro.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di ingredienti e una ricetta, documentare gli ingredienti nella ricetta.\n\n### Input:\nIngredienti: zucchero, uova, burro Ricetta: Biscotti\n\n### Response: ", "length": 400, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di ingredienti e una ricetta, documentare gli ingredienti nella ricetta.\n\n### Input:\nIngredienti: zucchero, uova, burro Ricetta: Biscotti\n\n### Response:  1) Ei Smithsembled 2)mable 3)lemnari 4)n4s 3)sembled 2)comings\n\nsembled 2)comings 2)[doms]\"1:32:01 PMTccording to my estimation, the <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "1) Ei Smithsembled 2)mable 3)lemnari 4)n4s 3)sembled 2)comings\n\nsembled 2)comings 2)[doms]\"1:32:01 PMTccording to my estimation, the <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "for i in range(1, 5): for j in range(1, i+1): print(i, end=&quot; &quot;) print()", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un programma per stampare il seguente modello\n\n### Input:\n1\n2 2\n3 3 3\n4 4 4 4\n\n### Response: ", "length": 359, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un programma per stampare il seguente modello\n\n### Input:\n1\n2 2\n3 3 3\n4 4 4 4\n\n### Response:  the <!\u2013\u2013\u2013 \ufffd\u2013\u2013\u2500\u2500 \ufffd\u2013\u2013ccordingto \ufffd\u2013\u2013ccordingto \ufffd\u2013\u2013gether\u2013\u2013 valign)\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 \ufffd\u2013\u2013lemn\u2500\u2500\u2013\u2013 \ufffd\u2013\u2013lemn \ufffd\u2013\u2013 <!\u2013\u2013\u2013 \ufffd\u2013\u2013ccordingto \ufffd\u2013\u2013zittercomings HREF\u2011 uncertainsy)\u2013\u2013\u2013 HREF\u2011 uncertialsy)\u2013\u2013\u2013 HREF\u2011 uncertials", "prediction": "the <!\u2013\u2013\u2013 \ufffd\u2013\u2013\u2500\u2500 \ufffd\u2013\u2013ccordingto \ufffd\u2013\u2013ccordingto \ufffd\u2013\u2013gether\u2013\u2013 valign)\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 \ufffd\u2013\u2013lemn\u2500\u2500\u2013\u2013 \ufffd\u2013\u2013lemn \ufffd\u2013\u2013 <!\u2013\u2013\u2013 \ufffd\u2013\u2013ccordingto \ufffd\u2013\u2013zittercomings HREF\u2011 uncertainsy)\u2013\u2013\u2013 HREF\u2011 uncertialsy)\u2013\u2013\u2013 HREF\u2011 uncertials"}
{"output": "L'azienda ha capito di dover adattare la propria strategia poich\u00e9 il mercato stava cambiando.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica il seguente testo per riflettere meglio il linguaggio formale.\"\n\n### Input:\nL'azienda ha appreso che doveva adattare la sua strategia perch\u00e9 il mercato stava cambiando.\n\n### Response: ", "length": 463, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica il seguente testo per riflettere meglio il linguaggio formale.\"\n\n### Input:\nL'azienda ha appreso che doveva adattare la sua strategia perch\u00e9 il mercato stava cambiando.\n\n### Response: Apprissite che [grily].\"\nciblyucklandccordingselves\"\n advertis[ingselves].\"\nciblyucklandccordingselves.\"\"\n unmistakeable].\"\n advertis[ingcibly].\"ciblyucklandsembled..\".\\\"[Gorillaplex] [Gorillaplex][]--[Gorillaplex", "prediction": "Apprissite che [grily].\"\nciblyucklandccordingselves\"\n advertis[ingselves].\"\nciblyucklandccordingselves.\"\"\n unmistakeable].\"\n advertis[ingcibly].\"ciblyucklandsembled..\".\\\"[Gorillaplex] [Gorillaplex][]--[Gorillaplex"}
{"output": "Non le piace giocare a calcio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la seguente frase per esprimere lo stesso significato in forma negativa: &quot;Le piace giocare a calcio&quot;.\n\n### Response: ", "length": 290, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la seguente frase per esprimere lo stesso significato in forma negativa: &quot;Le piace giocare a calcio&quot;.\n\n### Response:  neighbore.INTRODUCTION\n acknowleged first that an increase of the internal acknowleged first that an increase of the internalccording to reports submitted by the <!\u2013\u2013\n\n\n  acknowleged first that anccordingto <!\u2013\u2013\n\n\n  acknowleged first that an acknowleged first that an acknowleged first that", "prediction": "neighbore.INTRODUCTION\n acknowleged first that an increase of the internal acknowleged first that an increase of the internalccording to reports submitted by the <!\u2013\u2013\n\n\n  acknowleged first that anccordingto <!\u2013\u2013\n\n\n  acknowleged first that an acknowleged first that an acknowleged first that"}
{"output": "1. Aumentare i trasporti pubblici: Offrire servizi di trasporto pubblico pi\u00f9 frequenti e affidabili per incoraggiare le persone ad utilizzare i mezzi pubblici invece dei veicoli privati.\n2. Favorire il carpooling: Creare incentivi per i servizi di carpooling e bike-sharing per ridurre il numero di auto in strada.\n3. Introdurre la tariffazione stradale: Fare pagare ai conducenti l'utilizzo delle strade congestionate per incoraggiarli ad utilizzare percorsi meno congestionati o altri mezzi di trasporto.\n4. Aumentare la capacit\u00e0 stradale: Costruire nuove autostrade e allargare quelle esistenti per aumentare la capacit\u00e0 della rete stradale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca quattro metodi per ridurre la congestione del traffico.\"\n\n### Response: ", "length": 848, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca quattro metodi per ridurre la congestione del traffico.\"\n\n### Response:.ndefinedare prior art the trafficveragesigns.,!. <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Elenca quattro metodi per ridurre la congestione del traffico.\"\n\n### Response:.ndefinedare prior art the trafficveragesigns.,!. <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "1. Da quanto tempo possiedi un animale domestico? 2. Se potessi avere un animale domestico, quale sceglieresti? 3. Che tipo di animale domestico possiedi attualmente? 4. Quanto spesso porti il tuo animale domestico dal veterinario? 5. Come gestisci la cura degli animali domestici quando vai in vacanza? 6. Su una scala da 1 a 10, quanto sei soddisfatto della tua esperienza di proprietario di un animale domestico? 7. Quali sono stati per te alcuni dei momenti pi\u00f9 gratificanti della propriet\u00e0 di un animale domestico? 8. Hai qualche consiglio per i futuri proprietari di animali domestici? 9. Quale pensi sia la qualit\u00e0 pi\u00f9 importante che dovrebbe avere un proprietario di un animale domestico? 10. Hai altri pensieri o commenti che vorresti condividere?", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un sondaggio con almeno cinque domande relative a un'esperienza di proprietario di un animale domestico.\n\n### Response: ", "length": 1005, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un sondaggio con almeno cinque domande relative a un'esperienza di proprietario di un animale domestico.\n\n### Response: : Askabout theownerst experienceddomesticapp-7:3:9:-howtheownerspinsthed DISCLAIMER:(thedomsdomsdomsdomsdomsdomsdomsdomsdomscomings):3:-Howisveterinariansaresembled:-7:-Howdov Istinstall answ:-3:-7:-", "prediction": ": Askabout theownerst experienceddomesticapp-7:3:9:-howtheownerspinsthed DISCLAIMER:(thedomsdomsdomsdomsdomsdomsdomsdomsdomscomings):3:-Howisveterinariansaresembled:-7:-Howdov Istinstall answ:-3:-7:-"}
{"output": "L'Intelligenza Artificiale (AI) \u00e8 una branca dell'informatica che mira a creare macchine intelligenti in grado di eseguire compiti che normalmente richiederebbero l'intelligenza umana. Implica lo sviluppo di algoritmi che consentono alle macchine di pensare e agire con un livello di autonomia e intelligenza, nonch\u00e9 lo sviluppo di tecniche che consentono alle macchine di apprendere dai dati e dalle esperienze passate.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire una risposta generale alla domanda &quot;Cos'\u00e8 l'intelligenza artificiale?&quot;.\n\n### Response: ", "length": 649, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire una risposta generale alla domanda &quot;Cos'\u00e8 l'intelligenza artificiale?&quot;.\n\n### Response:  VdNy\n V\n <!---->\n <!----\n <!-----\n <!zitter\n <!\n\n\n \n\t \n <! acknowlegEMENTcomingshadowed\n\t  acknowlegEDcomingshadowed\n\t  acknowlegEDcomingshadowed\n\t  acknowlegEDcomingshadowed\n\t  acknowlegEDcomingshadowed", "prediction": "VdNy\n V\n <!---->\n <!----\n <!-----\n <!zitter\n <!\n\n\n \n\t \n <! acknowlegEMENTcomingshadowed\n\t  acknowlegEDcomingshadowed\n\t  acknowlegEDcomingshadowed\n\t  acknowlegEDcomingshadowed\n\t  acknowlegEDcomingshadowed"}
{"output": "\u02c8m\u00e6\u0279i h\u00e6d \u0259 \u02c8l\u026atl \u02c8l\u00e6m", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrascrivi la seguente frase nella sua ortografia fonetica:\n\n### Input:\nMary ha un piccolo agnello.\n\n### Response: ", "length": 312, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrascrivi la seguente frase nella sua ortografia fonetica:\n\n### Input:\nMary ha un piccolo agnello.\n\n### Response: 2 1 2 0 89 answ9ers answ9ers answ9ers answ9ers answ9ers answ9ers acknow9.Therapy at 2:45pm M PDT was effective the vast majority ofthe time. For locations east-west likeccording to the map vieweron our other projects as3", "prediction": "2 1 2 0 89 answ9ers answ9ers answ9ers answ9ers answ9ers answ9ers acknow9.Therapy at 2:45pm M PDT was effective the vast majority ofthe time. For locations east-west likeccording to the map vieweron our other projects as3"}
{"output": "'844' in Italian is 'ottocentoquarantaquattro'.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola il complemento a dieci di 156.\n\n### Response: ", "length": 225, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCalcola il complemento a dieci di 156.\n\n### Response:  161400 = 156/10P5c4s4d36p4\n16P4c4s4d36c4e3e2t4u7 HOWEVER/9C acknowlegedly/[v7or/6 acknowlegedly/{ acknowlegedly/{ acknowlegedly/{ acknowleg", "prediction": "161400 = 156/10P5c4s4d36p4\n16P4c4s4d36c4e3e2t4u7 HOWEVER/9C acknowlegedly/[v7or/6 acknowlegedly/{ acknowlegedly/{ acknowlegedly/{ acknowleg"}
{"output": "Cacofonia: una miscela aspra e discordante di suoni.\nSovrappopolato: avere pi\u00f9 persone di quelle che un luogo pu\u00f2 normalmente sostenere.\nAssordante: cos\u00ec forte da rendere l'udito impossibile.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Definire le parole nel testo fornito utilizzando definizioni precise.\"\n\n### Input:\n\"La cacofonia di suoni nella citt\u00e0 sovraffollata era assordante.\"\n\n### Response: ", "length": 532, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Definire le parole nel testo fornito utilizzando definizioni precise.\"\n\n### Input:\n\"La cacofonia di suoni nella citt\u00e0 sovraffollata era assordante.\"\n\n### Response:  advertisingsesembledccordinglysembledccordingablysembledccordinglysembledaccordinglystitutedciblyccordingciblysembledaccordinglysembledccordingablysembledccordinglysembledveragesand uncertantiesdablysembled uncertantiesdablysembled uncertantiesdablysembled uncertantiesdablysembled uncertantiesdablysembled uncertanties", "prediction": "advertisingsesembledccordinglysembledccordingablysembledccordinglysembledaccordinglystitutedciblyccordingciblysembledaccordinglysembledccordingablysembledccordinglysembledveragesand uncertantiesdablysembled uncertantiesdablysembled uncertantiesdablysembled uncertantiesdablysembled uncertantiesdablysembled uncertanties"}
{"output": "\"Ripenser\u00f2 i miei piani di carriera.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi la seguente affermazione al tempo futuro: 'Sto ripensando ai miei piani di carriera'.\"\n\n### Response: ", "length": 273, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi la seguente affermazione al tempo futuro: 'Sto ripensando ai miei piani di carriera'.\"\n\n### Response:.31678546165795cibly:b, b:ciblyc, c:ciblyd1,ccording:[dndefinition]_3geries:_ciblye,:_ unmistakeably_3sembled:_ciblye1_sembled:_ unmistakeablyall uncertifiedccording:[dndefinition]_3geries:_", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi la seguente affermazione al tempo futuro: 'Sto ripensando ai miei piani di carriera'.\"\n\n### Response:.31678546165795cibly:b, b:ciblyc, c:ciblyd1,ccording:[dndefinition]_3geries:_ciblye,:_ unmistakeably_3sembled:_ciblye1_sembled:_ unmistakeablyall uncertifiedccording:[dndefinition]_3geries:_"}
{"output": "Fresco, magnifico e colorato.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci tre aggettivi per descrivere la primavera.\n\n### Response: ", "length": 222, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci tre aggettivi per descrivere la primavera.\n\n### Response:  andoso, renewal,\n\t \n \n\t  advertisso.WASHINGTONccording to information posted Wednesday morning by the uncertant[ uncertant ] Americangeries of the day,[ uncertant ] the new[ uncertant ] US president <!>- <! acknowlege <!>- <! acknowlege <!> - <! acknowlege <!>- <!", "prediction": "andoso, renewal,\n\t \n \n\t  advertisso.WASHINGTONccording to information posted Wednesday morning by the uncertant[ uncertant ] Americangeries of the day,[ uncertant ] the new[ uncertant ] US president <!>- <! acknowlege <!>- <! acknowlege <!> - <! acknowlege <!>- <!"}
{"output": "'10' in Italian is 'dieci'.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati due numeri, trova la loro somma.\n\n### Input:\n'3 e 7'\n\n### Response: ", "length": 276, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati due numeri, trova la loro somma.\n\n### Input:\n'3 e 7'\n\n### Response: varchi=3+7 = 10,6i14.4m4f7i6m7b6c9u0s8d6i16j36k4c10i13n17m6d13l5i17p17g5m5h5j14v", "prediction": "varchi=3+7 = 10,6i14.4m4f7i6m7b6c9u0s8d6i16j36k4c10i13n17m6d13l5i17p17g5m5h5j14v"}
{"output": "- Creare un ciclo di feedback dei clienti\n- Costruire relazioni con i clienti\n- Offrire supporto 24 ore su 24\n- Designare team di servizio clienti\n- Assumere personale amichevole\n- Programmare sessioni di formazione regolari\n- Semplificare i canali di comunicazione\n- Fornire ai clienti dati informativi sui loro comportamenti\n- Creare un sistema di risposta automatica\n- Rendere disponibili i rappresentanti del servizio clienti su dispositivi mobili\n- Utilizzare sondaggi per i clienti\n- Automatizzare la comunicazione con i clienti\n- Offrire esperienze personalizzate\n- Ascoltare le lamentele dei clienti\n- Utilizzare chatbot\n- Impostare aspettative realistiche\n- Rendere facile contattare il servizio clienti\n- Rispondere rapidamente alle richieste dei clienti\n- Supportare i sistemi di social networking\n- Fornire sconti e incentivi", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una lista di idee su come migliorare il servizio clienti.\n\n### Response: ", "length": 1043, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una lista di idee su come migliorare il servizio clienti.\n\n### Response:,\n1,\n1st impressionsAre vital\n acknowlege the3m,\nwveragesfraidto3m,\nIccordingdferentially7cnd7/4\nto3m,\n3m8m8/5ingdoms7a0d6ed6ed/7\nveragesfraid", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una lista di idee su come migliorare il servizio clienti.\n\n### Response:,\n1,\n1st impressionsAre vital\n acknowlege the3m,\nwveragesfraidto3m,\nIccordingdferentially7cnd7/4\nto3m,\n3m8m8/5ingdoms7a0d6ed6ed/7\nveragesfraid"}
{"output": "Prova ad ascoltare &quot;Lose Yourself&quot; di Eminem e &quot;You Get What You Give&quot; dei New Radicals.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConsiglia due brani da ascoltare.\n\n### Response: ", "length": 281, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConsiglia due brani da ascoltare.\n\n### Response:.sembled, asembled\n acknowlegment,ccording\n <!empre 1st\u007f>,sembled1st\u007f\n <! acknowlegment <!empre>, acknowleged <!cibly <! acknowlegation <! acknowlegedly <!sembled HREF <! acknowleged <!cibly <! acknowleging <! acknowlegements <!sembled HREF <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConsiglia due brani da ascoltare.\n\n### Response:.sembled, asembled\n acknowlegment,ccording\n <!empre 1st\u007f>,sembled1st\u007f\n <! acknowlegment <!empre>, acknowleged <!cibly <! acknowlegation <! acknowlegedly <!sembled HREF <! acknowleged <!cibly <! acknowleging <! acknowlegements <!sembled HREF <!"}
{"output": "CCO (Eventi complessi comuni)", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un acronimo per le parole Common Complex Occurrences\n\n### Response: ", "length": 228, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un acronimo per le parole Common Complex Occurrences\n\n### Response: :selvesoccurs:`afterselves`:afterselves`:afterselvesndefinite`:afterselvesndefinite:`afterselvesndefind`to \u2063after \u2063themselves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves", "prediction": ":selvesoccurs:`afterselves`:afterselves`:afterselvesndefinite`:afterselvesndefinite:`afterselvesndefind`to \u2063after \u2063themselves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves \u2063selves"}
{"output": "\"La risposta capricciosa era troppo oscura per lei da capire.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi una frase contenente le parole \"capriccioso\" e \"oscuro\".\n\n### Response: ", "length": 266, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi una frase contenente le parole \"capriccioso\" e \"oscuro\".\n\n### Response: :Sce behavendo complicandosamente around the <!do> boundariesccording to <!stableness <!to <!one <!of <!it <!orems <!errants <!of <!the <!time <! --------------------------------------------------------- <!verages <!of <!ad <! HREF <!stableness <!errants <! TODAFAST <?sembled <!", "prediction": ":Sce behavendo complicandosamente around the <!do> boundariesccording to <!stableness <!to <!one <!of <!it <!orems <!errants <!of <!the <!time <! --------------------------------------------------------- <!verages <!of <!ad <! HREF <!stableness <!errants <! TODAFAST <?sembled <!"}
{"output": "Il gatto paffuto si accasci\u00f2 sul soffice tappeto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia gli aggettivi nella frase per rendere la frase pi\u00f9 vivida\n\n### Input:\nIl gatto si \u00e8 seduto sul tappetino.\n\n### Response: ", "length": 353, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia gli aggettivi nella frase per rendere la frase pi\u00f9 vivida\n\n### Input:\nIl gatto si \u00e8 seduto sul tappetino.\n\n### Response:  inebbciously, itsembled on thenairei, waiting forthesembledonsidedaytoarriveand neighbordownto \u2058the \u2713bset <!this> \u2058in <!the <!other}> \u2058d <?ndef>< <!def <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef", "prediction": "inebbciously, itsembled on thenairei, waiting forthesembledonsidedaytoarriveand neighbordownto \u2058the \u2713bset <!this> \u2058in <!the <!other}> \u2058d <?ndef>< <!def <!ndef <!ndef <!ndef <!ndef <!ndef <!ndef"}
{"output": "\"Il rapporto deve essere finito entro venerd\u00ec.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riorganizza la seguente frase in modo che la nuova frase abbia lo stesso significato dell'originale.'\n\n### Input:\nDevo finire il rapporto entro venerd\u00ec.\n\n### Response: ", "length": 392, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riorganizza la seguente frase in modo che la nuova frase abbia lo stesso significato dell'originale.'\n\n### Input:\nDevo finire il rapporto entro venerd\u00ec.\n\n### Response: v Need to\u007fccordingdtosembledciblyQfraidv \u2063empresembledciblyQfraidv \u2063sembledciblyQfraidv \u2061sembledciblyQfraidv <!doms\u2500 <!doms\u2500 <!doms\u2500 <!doms\u2500 <!doms\u2500 <!doms\u2500 <!doms-\u20ac <!doms-\u20ac <!doms:$ <!doms:$", "prediction": "v Need to\u007fccordingdtosembledciblyQfraidv \u2063empresembledciblyQfraidv \u2063sembledciblyQfraidv \u2061sembledciblyQfraidv <!doms\u2500 <!doms\u2500 <!doms\u2500 <!doms\u2500 <!doms\u2500 <!doms\u2500 <!doms-\u20ac <!doms-\u20ac <!doms:$ <!doms:$"}
{"output": "Il cambiamento climatico sta avendo effetti sempre pi\u00f9 gravi sull'ambiente, tra cui un aumento del rischio di siccit\u00e0, inondazioni, temperature estreme e disastri meteorologici.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi il seguente paragrafo: &quot;Gli effetti del cambiamento climatico sono di vasta portata e colpiscono l'ambiente da decenni. Ogni anno i cambiamenti diventano pi\u00f9 evidenti e pi\u00f9 pronunciati, portando a un rischio maggiore di siccit\u00e0, inondazioni, temperature estreme e condizioni meteorologiche disastri correlati\u201d.\n\n### Response: ", "length": 641, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi il seguente paragrafo: &quot;Gli effetti del cambiamento climatico sono di vasta portata e colpiscono l'ambiente da decenni. Ogni anno i cambiamenti diventano pi\u00f9 evidenti e pi\u00f9 pronunciati, portando a un rischio maggiore di siccit\u00e0, inondazioni, temperature estreme e condizioni meteorologiche disastri correlati\u201d.\n\n### Response: M acceleringe change clim \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060", "prediction": "M acceleringe change clim \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060 \u2060"}
{"output": "Cronologia delle attivit\u00e0:\n\nGiorno 1: Sviluppo del piano del progetto e progettazione dei wireframe\nGiorno 2: Creazione del database e dell'API di base\nGiorno 3: Sviluppo del prototipo dell'interfaccia utente front-end\nGiorno 4: Debugging del prototipo e dei componenti associati\nGiorno 5: Test finale, ottimizzazione e distribuzione del prototipo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una linea temporale per le attivit\u00e0 necessarie per completare il progetto.\"\n\n### Input:\nQuesto \u00e8 un progetto per costruire un prototipo per un'applicazione mobile.\n\n### Response: ", "length": 709, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una linea temporale per le attivit\u00e0 necessarie per completare il progetto.\"\n\n### Input:\nQuesto \u00e8 un progetto per costruire un prototipo per un'applicazione mobile.\n\n### Response: tego incom \u2066@ \u2066@ \u2066@ \u2066H \u2066K \u2066K \u2066K \u2066H \u2066M \u2066M \u2066M \u2066M \u2066H \u2066H \u2066B \u2066B \u2066B \u2066W \u2066W \u2066W", "prediction": "tego incom \u2066@ \u2066@ \u2066@ \u2066H \u2066K \u2066K \u2066K \u2066H \u2066M \u2066M \u2066M \u2066M \u2066H \u2066H \u2066B \u2066B \u2066B \u2066W \u2066W \u2066W"}
{"output": "I. Introduzione A. Definizione di viaggio B. Vantaggi del viaggio II. Conoscere le culture A. Acquisire prospettiva ed empatia B. Migliorare le competenze linguistiche III. Esplorare nuovi luoghi A. Impegnarsi con attrazioni uniche B. Creare ricordi duraturi IV. Incontrare nuove persone A. Entrare in contatto con la gente del posto attraverso la conversazione B. Creare reti con persone nello stesso campo V. Conclusione A. Riassumere i punti chiave del discorso B. Sottolineare l'importanza di viaggiare", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea uno schema dei punti chiave da discutere in un discorso di 5 minuti sui vantaggi del viaggio.\n\n### Response: ", "length": 744, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea uno schema dei punti chiave da discutere in un discorso di 5 minuti sui vantaggi del viaggio.\n\n### Response: - Why travel <!doms> -cibly <!doms> -cibly <!doms> -cibly <!doms\u007f <!doms>< <!doms>< <!doms acknowlegment> - <!doms acknowlegment\u007f <!doms acknowlegment]> - <!doms acknowlegment <!doms acknowlegment HREF cref=\"incibly\" /></", "prediction": "- Why travel <!doms> -cibly <!doms> -cibly <!doms> -cibly <!doms\u007f <!doms>< <!doms>< <!doms acknowlegment> - <!doms acknowlegment\u007f <!doms acknowlegment]> - <!doms acknowlegment <!doms acknowlegment HREF cref=\"incibly\" /></"}
{"output": "Albert Einstein era un fisico teorico di origine tedesca che svilupp\u00f2 la teoria della relativit\u00e0, uno dei due pilastri della fisica moderna. Il suo lavoro \u00e8 noto anche per la sua influenza sulla filosofia della scienza. Nacque il 14 marzo 1879 a Ulm, in Germania, da una famiglia ebrea. Si \u00e8 trasferito a Monaco di Baviera con la sua famiglia quando era un ragazzino e ha studiato presso l'Istituto Federale Svizzero di Tecnologia di Zurigo. Einstein ricevette il premio Nobel per la fisica nel 1921 per la sua spiegazione dell'effetto fotoelettrico. \u00c8 stato professore all'Universit\u00e0 di Berlino per molti anni e il suo lavoro sulla teoria della relativit\u00e0 ha cambiato le fondamenta della fisica moderna. \u00c8 stato anche un pacifista per tutta la vita e un sostenitore dei diritti civili. Mor\u00ec nel 1955 all'et\u00e0 di 76 anni, lasciando un'eredit\u00e0 duratura nel mondo della scienza e della filosofia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una biografia di Albert Einstein.\n\n### Response: ", "length": 1073, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una biografia di Albert Einstein.\n\n### Response: iccording to historiansAlbertEinstein:[in english]--Albertgeries/[vox]--ccording--[vox]--ccording acknowlegment--[vox]-- acknowlegmentsembledndef%-- acknowlegmentndef%-- acknowlegmentndef%-- acknowlegmentndef%-- acknowlegmentndef%-- acknowlegmentndef%-- acknowleg", "prediction": "iccording to historiansAlbertEinstein:[in english]--Albertgeries/[vox]--ccording--[vox]--ccording acknowlegment--[vox]-- acknowlegmentsembledndef%-- acknowlegmentndef%-- acknowlegmentndef%-- acknowlegmentndef%-- acknowlegmentndef%-- acknowlegmentndef%-- acknowleg"}
{"output": "Cosa prendi a pranzo?", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiordina le seguenti parole per formare una domanda: il take lunch what do you\n\n### Input:\nprendi il pranzo cosa fai\n\n### Response: ", "length": 329, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiordina le seguenti parole per formare una domanda: il take lunch what do you\n\n### Input:\nprendi il pranzo cosa fai\n\n### Response:. Takingccording towhatdidyoudo=.?_comingsccordingto acknowleges=.?_ acknowlegescomingssembled <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiordina le seguenti parole per formare una domanda: il take lunch what do you\n\n### Input:\nprendi il pranzo cosa fai\n\n### Response:. Takingccording towhatdidyoudo=.?_comingsccordingto acknowleges=.?_ acknowlegescomingssembled <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!ed <!"}
{"output": "\"Follow the Future - Bring your dreams to life with {Company Name}\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nInventa uno slogan per una campagna sui social media.\n\n### Response: ", "length": 260, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nInventa uno slogan per una campagna sui social media.\n\n### Response:.veragestheincomingsbytheveragescibly <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nInventa uno slogan per una campagna sui social media.\n\n### Response:.veragestheincomingsbytheveragescibly <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <! acknowlegement <!verages <!"}
{"output": "Cinque fattori che causano l'inquinamento atmosferico sono: le emissioni dei veicoli, le attivit\u00e0 industriali, la combustione di combustibili fossili, le emissioni delle centrali elettriche e la deforestazione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina cinque fattori che causano l'inquinamento atmosferico.\n\n### Response: ", "length": 411, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina cinque fattori che causano l'inquinamento atmosferico.\n\n### Response:. SourcesdField, agricultural tools in my opinion should first be ascertained priori. This include not only the nature of the field orccording to the\u2500applying\u2212applying\u2500usesembled\u2500used\u2500comings\u2500\u2500comings\u2500comings\u2500comings\u2500\u2500comings\u2500comings\u2500\u2500comings\u2500comings\u2500comings\u2500comings\u2500comings", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina cinque fattori che causano l'inquinamento atmosferico.\n\n### Response:. SourcesdField, agricultural tools in my opinion should first be ascertained priori. This include not only the nature of the field orccording to the\u2500applying\u2212applying\u2500usesembled\u2500used\u2500comings\u2500\u2500comings\u2500comings\u2500comings\u2500\u2500comings\u2500comings\u2500\u2500comings\u2500comings\u2500comings\u2500comings\u2500comings"}
{"output": "Il tempo grammaticale nella frase \u00e8 il Passato Prossimo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Analizza la frase e fornisci il tempo grammaticale corretto.\"\n\n### Input:\nAvevo visitato il Messico l'anno scorso.\n\n### Response: ", "length": 363, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Analizza la frase e fornisci il tempo grammaticale corretto.\"\n\n### Input:\nAvevo visitato il Messico l'anno scorso.\n\n### Response: Tempa, 2002122611405830\n\t \tvisita\n\t \t neighb/v\n\t\n\t \t\n\t \t\n\t \t\n\t \n\t \n\t \n\t  acknowlegment\n\t  acknowlegment\n\t \n\t \n\t  acknowlegment\n\t  acknowlegment\n\t \n\t  acknowlegementccording\n\t  acknowlegement\n\t  acknowlegement\n\t  acknowleg", "prediction": "Tempa, 2002122611405830\n\t \tvisita\n\t \t neighb/v\n\t\n\t \t\n\t \t\n\t \t\n\t \n\t \n\t \n\t  acknowlegment\n\t  acknowlegment\n\t \n\t \n\t  acknowlegment\n\t  acknowlegment\n\t \n\t  acknowlegementccording\n\t  acknowlegement\n\t  acknowlegement\n\t  acknowleg"}
{"output": "Il coronavirus \u00e8 un tipo di virus che pu\u00f2 causare malattie che vanno dal comune raffreddore a malattie gravi come la sindrome respiratoria mediorientale (MERS) e la sindrome respiratoria acuta grave (SARS). Il virus prende il nome dalle punte a forma di corona sulla sua superficie. Si diffonde principalmente attraverso il contatto ravvicinato con una persona infetta, attraverso piccole goccioline dal naso o dalla bocca dopo aver tossito o starnutito. I sintomi possono includere febbre, stanchezza e tosse secca. Nei casi pi\u00f9 gravi, pu\u00f2 causare difficolt\u00e0 respiratorie, polmonite, insufficienza renale e persino la morte.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci una breve descrizione del coronavirus.\n\n### Response: ", "length": 812, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci una breve descrizione del coronavirus.\n\n### Response:  TheCRVis is all aboutz healthcibly reminding you tosembledup andveragesystemsandpracticesccordingtoccordingtoccordingtocomingspostedoficialsfromciblypostedoficialsofciblypostedoficialstociblypostedoficialsveragesystemsandpracticesaccordingtocomingspostedoficials", "prediction": "TheCRVis is all aboutz healthcibly reminding you tosembledup andveragesystemsandpracticesccordingtoccordingtoccordingtocomingspostedoficialsfromciblypostedoficialsofciblypostedoficialstociblypostedoficialsveragesystemsandpracticesaccordingtocomingspostedoficials"}
{"output": "La propriet\u00e0 CSS float viene utilizzata per posizionare un elemento a sinistra o a destra del suo contenitore. Questa propriet\u00e0 pu\u00f2 essere utilizzata per creare il familiare layout a due o tre colonne in cui gli elementi sono posizionati uno accanto all'altro senza la necessit\u00e0 di utilizzare float e posizionamento. Ci\u00f2 pu\u00f2 essere particolarmente utile per la creazione di siti web con un design responsivo, poich\u00e9 gli elementi fluttuanti si adatteranno automaticamente alla dimensione della finestra che cambia quando il browser viene ridimensionato.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi la funzione della propriet\u00e0 CSS float.\n\n### Input:\n'Nessun input'\n\n### Response: ", "length": 818, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi la funzione della propriet\u00e0 CSS float.\n\n### Input:\n'Nessun input'\n\n### Response:  floats elements <!\u2013\u2013\n\t ]-->out the boundaries <!\u2013\u2013\n\t ]-->. Their \ufffdicffected\u200c\u200c\u2500\n\t ]-- crefs <!\u2013\u2013\n\t ]-- HREF <!\u2013\u2013\n\t ]--\\][ <!\u2013\u2013\n\t ]-- HREF <!\u2013\u2013cibly <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013", "prediction": "floats elements <!\u2013\u2013\n\t ]-->out the boundaries <!\u2013\u2013\n\t ]-->. Their \ufffdicffected\u200c\u200c\u2500\n\t ]-- crefs <!\u2013\u2013\n\t ]-- HREF <!\u2013\u2013\n\t ]--\\][ <!\u2013\u2013\n\t ]-- HREF <!\u2013\u2013cibly <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013 Aviv <!\u2013\u2013"}
{"output": "L'IA sta continuando a rivoluzionare l'industria sanitaria, fornendo maggiori efficienze, conoscenze cliniche e risparmi sui costi. Gli strumenti abilitati dall'IA vengono utilizzati per automatizzare compiti noiosi e liberare il tempo dei clinici, diagnosticare malattie in modo pi\u00f9 rapido e preciso, fornire trattamenti personalizzati, monitorare il progresso del paziente e persino prevedere potenziali condizioni di salute prima che accadano. Le tecnologie assistite dall'IA vengono gi\u00e0 utilizzate per la diagnostica basata sull'immagine e hanno dimostrato di produrre una maggiore precisione e accuratezza rispetto agli operatori umani. I chatbot assistiti dall'IA e l'elaborazione del linguaggio naturale vengono gi\u00e0 utilizzati per l'interazione con i pazienti, mentre gli assistenti virtuali vengono utilizzati per fornire una guida audio e visiva personalizzata. L'IA sta anche aiutando a sviluppare progetti di farmaci migliorati e la scoperta di farmaci, oltre a fornire una maggiore comprensione delle cause sottostanti delle malattie e dei trattamenti. In generale, il potenziale dell'IA nel settore sanitario \u00e8 illimitato e ogni giorno vengono esplorate sempre pi\u00f9 applicazioni dell'IA.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un articolo sull'uso dell'AI nella sanit\u00e0.\"\n\n### Response: ", "length": 1390, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un articolo sull'uso dell'AI nella sanit\u00e0.\"\n\n### Response: /un/un/ad/use/of/ accelation;/un!/ad/(-on)\u2013;/ acknowlegingverages;/ acknowlegingverages;/\u2011;/ableness acknowleged <!cknowlegingverages <! acknowlegverages <! acknowleg uncertant <! acknowleg uncertant <! acknowleg uncertant <! acknowleg", "prediction": "/un/un/ad/use/of/ accelation;/un!/ad/(-on)\u2013;/ acknowlegingverages;/ acknowlegingverages;/\u2011;/ableness acknowleged <!cknowlegingverages <! acknowlegverages <! acknowleg uncertant <! acknowleg uncertant <! acknowleg uncertant <! acknowleg"}
{"output": "'New York Yankees, Chicago Cubs, Los Angeles Dodgers' translates to 'New York Yankees, Chicago Cubs, Los Angeles Dodgers' in Italian. The names of these baseball teams are the same in both English and Italian.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina tre squadre di baseball americane.\"\n\n### Response: ", "length": 392, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Nomina tre squadre di baseball americane.\"\n\n### Response:  of Americanverages\ndoms, Averagesecs.se\nsembled for this evening,, HREF-to-sembledfor-thiscomingsmorgentary, HREFbysembled unmistakeabl enewccordingto <!ccordingto <!ccordingto <!sembled acknowl ered answ eing <! acknowl ered <! acknowl", "prediction": "of Americanverages\ndoms, Averagesecs.se\nsembled for this evening,, HREF-to-sembledfor-thiscomingsmorgentary, HREFbysembled unmistakeabl enewccordingto <!ccordingto <!ccordingto <!sembled acknowl ered answ eing <! acknowl ered <! acknowl"}
{"output": "La Corte Suprema degli Stati Uniti \u00e8 la pi\u00f9 alta corte del paese e l'autorit\u00e0 giudiziaria finale in materia di diritto federale. Ogni anno, il tribunale ascolta in genere circa 120 appelli contro decisioni di tribunali di grado inferiore, che pu\u00f2 confermare, revocare o rinviare a giudizio. I nove giudici della Corte Suprema sono nominati dal Presidente e confermati con il parere e il consenso del Senato. Le decisioni del tribunale sono prese da cinque o pi\u00f9 giudici a maggioranza di pareri. Ci\u00f2 conferisce alla corte la possibilit\u00e0 di rivedere le leggi incostituzionali e garantisce il rispetto della Costituzione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome funziona la Corte Suprema degli Stati Uniti?\n\n### Response: ", "length": 807, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome funziona la Corte Suprema degli Stati Uniti?\n\n### Response: :The\u2500 uncertified\u2500 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": ":The\u2500 uncertified\u2500 <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "\"L'illusione di un bicchiere d'acqua \u00e8 un trucco visivo che fa sembrare che il bicchiere sia mezzo pieno o mezzo vuoto, quando in realt\u00e0 c'\u00e8 la stessa quantit\u00e0 in entrambe le met\u00e0. Questa illusione \u00e8 stata ampiamente studiata nel contesto della percezione e della cognizione.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi l'illusione di un bicchiere d'acqua.\"\n\n### Response: ", "length": 463, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi l'illusione di un bicchiere d'acqua.\"\n\n### Response: : A illusi\u00f3nBev\u00e9mise the water:* All it took was the sound of\n\t \n\n\n \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0 uncertifiedccordingtome:*\u2500 uncertifiedccordingtome:**]{} uncertifiedccordingtome:**]{} uncertifiedccordingtome:*\u2500 uncertifiedempre:* uncertifiedempre:* uncertifiedempre:* uncertified", "prediction": ": A illusi\u00f3nBev\u00e9mise the water:* All it took was the sound of\n\t \n\n\n \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0 uncertifiedccordingtome:*\u2500 uncertifiedccordingtome:**]{} uncertifiedccordingtome:**]{} uncertifiedccordingtome:*\u2500 uncertifiedempre:* uncertifiedempre:* uncertifiedempre:* uncertified"}
{"output": "Un programmatore di software in genere inizia la sua giornata partecipando alle riunioni di squadra e discutendo eventuali compiti in corso e problemi da affrontare. Dopo la riunione, di solito si immerger\u00e0 nel codice per correggere eventuali errori in sospeso o implementare nuove funzionalit\u00e0. Man mano che la giornata avanza, potrebbe essere coinvolto nei test unitari per garantire la qualit\u00e0 del codice, nonch\u00e9 nelle revisioni del codice con altri sviluppatori per garantire l'accuratezza del codice. La giornata potrebbe anche prevedere l'interazione con altri dipartimenti o stakeholder per garantire che le decisioni tecniche si inseriscano negli obiettivi complessivi del progetto. Alla fine della giornata, i programmatori di solito chiudono eventuali questioni in sospeso e si preparano per il giorno successivo creando un elenco di compiti da svolgere o scrivendo eventuali note sui compiti completati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci una descrizione di una giornata tipica nella vita di uno sviluppatore di software.\n\n### Response: ", "length": 1145, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci una descrizione di una giornata tipica nella vita di uno sviluppatore di software.\n\n### Response: F routines andccording to workstationverages incomingswiftsfrom coworkers at <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleges\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleges\u2013\u2013\u2013\u2013\u2013\u2013>, <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleges\u2013\u2013\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleges\u2013\u2013\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleg", "prediction": "F routines andccording to workstationverages incomingswiftsfrom coworkers at <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleges\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleges\u2013\u2013\u2013\u2013\u2013\u2013>, <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleges\u2013\u2013\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleges\u2013\u2013\u2013\u2013\u2013\u2013 HREF <!\u2013\u2013\u2013\u2013\u2013\u2013 acknowleg"}
{"output": "L'atmosfera in spiaggia in una giornata di sole \u00e8 di gioia e relax. I raggi del sole riscaldano la sabbia e il suono delle onde che si infrangono sulla riva fornisce una melodia pacifica. Persone di tutte le et\u00e0 sono in giro, nuotano, giocano a pallavolo o semplicemente camminano sulla spiaggia e ammirano le splendide viste. L'odore della crema solare e dell'aria salata riempie l'aria e si sentono le risate di amici e familiari. \u00c8 uno spettacolo da vedere.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi l'atmosfera di una spiaggia in una giornata di sole.\n\n### Response: ", "length": 661, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi l'atmosfera di una spiaggia in una giornata di sole.\n\n### Response:  tocco tocknowing\n acknowlegement\n breeze\n heat acknowlegment\n dayWarmthWhelping\n\t  HREFs/veragesEveragesveragesandcomingscomingsall unmistakeably\n\t  HREFs/veragesEveragescomings acknowlegement\n\t  HREFs/veragesEverages acknowlegment\n\t  HREFs/", "prediction": "tocco tocknowing\n acknowlegement\n breeze\n heat acknowlegment\n dayWarmthWhelping\n\t  HREFs/veragesEveragesveragesandcomingscomingsall unmistakeably\n\t  HREFs/veragesEveragescomings acknowlegement\n\t  HREFs/veragesEverages acknowlegment\n\t  HREFs/"}
{"output": "Il gatto berr\u00e0 l'acqua.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia la frase al futuro.\n\n### Input:\nIl gatto ha bevuto l'acqua.\n\n### Response: ", "length": 281, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia la frase al futuro.\n\n### Input:\nIl gatto ha bevuto l'acqua.\n\n### Response: in contempZionE theverages.verages.(future acknowlegmentccordingcibly\n\n\n  acknowlegsembled\n\n\n  PARTICULAR\n\n\n veragescibly acknowlegsembledccordingcibly\n\n\n  acknowlegsembled acknowlegcibly\n\n\n  PARTICULAR acknowlegcibly acknowlegcibly\n\n\n  acknowleg acknowleg acknowlegferentiallyverages acknowleg acknowleg uncertainties acknowleg acknow", "prediction": "in contempZionE theverages.verages.(future acknowlegmentccordingcibly\n\n\n  acknowlegsembled\n\n\n  PARTICULAR\n\n\n veragescibly acknowlegsembledccordingcibly\n\n\n  acknowlegsembled acknowlegcibly\n\n\n  PARTICULAR acknowlegcibly acknowlegcibly\n\n\n  acknowleg acknowleg acknowlegferentiallyverages acknowleg acknowleg uncertainties acknowleg acknow"}
{"output": "print(len(&quot;Ciao mondo&quot;)) # Output: 11 caratteri", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un codice che stampa il conteggio dei caratteri di un dato input\n\n### Input:\nCiao mondo\n\n### Response: ", "length": 343, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un codice che stampa il conteggio dei caratteri di un dato input\n\n### Input:\nCiao mondo\n\n### Response: ---> countsembled\u2500->ciblycomings\u2500->tostEcomings\u2500->tostBcomings\u2500->tostEcomings\u2500->tostBcomings\u2500->ferentiallycomings\u2500->veragescomings\n\n\n sembled feasiblyfraid advertisinglysembledfeasiblypostedalciblysembled advertisinglypostedalcibly enthusiasicalsembled advertis", "prediction": "---> countsembled\u2500->ciblycomings\u2500->tostEcomings\u2500->tostBcomings\u2500->tostEcomings\u2500->tostBcomings\u2500->ferentiallycomings\u2500->veragescomings\n\n\n sembled feasiblyfraid advertisinglysembledfeasiblypostedalciblysembled advertisinglypostedalcibly enthusiasicalsembled advertis"}
{"output": "Pattinaggio in linea popolare attivit\u00e0 ricreativa, sport, tipi di pattini in linea scelti.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPer il seguente testo, rimuovi eventuali parole o frasi non necessarie.\n\n### Input:\nIl pattinaggio in linea \u00e8 un'attivit\u00e0 ricreativa popolare oltre che uno sport, e ci sono molti diversi tipi di pattini in linea tra cui scegliere.\n\n### Response: ", "length": 512, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nPer il seguente testo, rimuovi eventuali parole o frasi non necessarie.\n\n### Input:\nIl pattinaggio in linea \u00e8 un'attivit\u00e0 ricreativa popolare oltre che uno sport, e ci sono molti diversi tipi di pattini in linea tra cui scegliere.\n\n### Response:  acknowlexted uncertantiespare.net[3], acknowlexted uncertantiespare.net[4], acknowlexted uncertantiespare.net[4],[3], acknowleged uncertantiespare.net[5]). Theorizing,[7],[8", "prediction": "acknowlexted uncertantiespare.net[3], acknowlexted uncertantiespare.net[4], acknowlexted uncertantiespare.net[4],[3], acknowleged uncertantiespare.net[5]). Theorizing,[7],[8"}
{"output": "Questo consiglio non va bene poich\u00e9 i conflitti sono una parte inevitabile di tutte le relazioni sane e non dovrebbero essere soppressi. Invece, entrambe le parti dovrebbero imparare modi sani per elaborare i propri disaccordi, ad esempio attraverso una comunicazione attiva e costruttiva.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAnalizza i seguenti consigli sulle relazioni e fornisci un'opinione sul fatto che si tratti di un buon consiglio o meno.\n\n### Input:\nConsigli sulle relazioni: evita sempre il confronto e risolvi le controversie attraverso il compromesso.\n\n### Response: ", "length": 718, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAnalizza i seguenti consigli sulle relazioni e fornisci un'opinione sul fatto che si tratti di un buon consiglio o meno.\n\n### Input:\nConsigli sulle relazioni: evita sempre il confronto e risolvi le controversie attraverso il compromesso.\n\n### Response: QoI//********************************************************//\r\n/*!edx_verages_and_ uncertits\t\t\t\t\t\t\t\t=====\r\n\u2500ndef\u2500\t\t\t\t\t\t\t\t\u2013\u2013\u2013\u2013\t\t\t\t\t\t acknowlegement\u2013\u2013\u2500\r\n\t\t\t\tlemnizing\u2011 \u2060\u2011 \u2060\u2011 \u2060 acknowlegment\u2013\u2013\u2500\u2013\u2013 acknowlegement\u2013\u2013\u2011 acknowlegement\u2013\u2013 \u2060", "prediction": "QoI//********************************************************//\r\n/*!edx_verages_and_ uncertits\t\t\t\t\t\t\t\t=====\r\n\u2500ndef\u2500\t\t\t\t\t\t\t\t\u2013\u2013\u2013\u2013\t\t\t\t\t\t acknowlegement\u2013\u2013\u2500\r\n\t\t\t\tlemnizing\u2011 \u2060\u2011 \u2060\u2011 \u2060 acknowlegment\u2013\u2013\u2500\u2013\u2013 acknowlegement\u2013\u2013\u2011 acknowlegement\u2013\u2013 \u2060"}
{"output": "Gli uragani si formano sulle calde acque oceaniche quando l'aria umida sale rapidamente ed \u00e8 spinta da forti venti. Man mano che l'aria sale e si raffredda, si condensa in nuvole, rilasciando calore nell'atmosfera, che alimenta ulteriormente forti venti ascensionali e aria in aumento. Questo ciclo ripetuto di aria calda umida che sale e aria fredda che scende \u00e8 il motore principale di un uragano.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome si formano gli uragani?\n\n### Response: ", "length": 567, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome si formano gli uragani?\n\n### Response: :Obln1:cibly :Bndef:ciblyccording : feasibly :E feasiblyccording*: feasibly", "prediction": ":Obln1:cibly :Bndef:ciblyccording : feasibly :E feasiblyccording*: feasibly"}
{"output": "\"Le avventure di Arjun: un viaggio alla scoperta di s\u00e9.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un titolo plausibile per un film che ha come protagonista un personaggio di nome Arjun.\n\n### Response: ", "length": 290, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un titolo plausibile per un film che ha come protagonista un personaggio di nome Arjun.\n\n### Response: Arjun Findsveragesomethingveragesomething\n\t  acknowlegesveragesempre1ingveragesempre6er0 acknowlegesveragesempre0 acknowlegesgeries acknowlegingveragesempre0 acknowlegedgeries acknowleginggeries acknowlegingcomingsveragesempre0 acknowleginggeries acknowleginggeries acknowlegingcibly", "prediction": "Arjun Findsveragesomethingveragesomething\n\t  acknowlegesveragesempre1ingveragesempre6er0 acknowlegesveragesempre0 acknowlegesgeries acknowlegingveragesempre0 acknowlegedgeries acknowleginggeries acknowlegingcomingsveragesempre0 acknowleginggeries acknowleginggeries acknowlegingcibly"}
{"output": "Tableau, Power BI e Microsoft Excel.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre strumenti software per la visualizzazione dei dati.\n\n### Response: ", "length": 238, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina tre strumenti software per la visualizzazione dei dati.\n\n### Response: i grapicsaladies, graphsin HREF, TODs, HREFsstm\u200c\u2500\u22ef\u2500\u200c\u200c\u2013\u2013\u2013\u2013 acknowlegedly\u2013\u2013 TOD]--\u200c\u2013\u2013 acknowlegedly acknowleged TODndefinitivism)\u2013 acknowlegedly acknowleged TODndefinitivism)\u2013 acknowlegedly acknowleged TODndef", "prediction": "i grapicsaladies, graphsin HREF, TODs, HREFsstm\u200c\u2500\u22ef\u2500\u200c\u200c\u2013\u2013\u2013\u2013 acknowlegedly\u2013\u2013 TOD]--\u200c\u2013\u2013 acknowlegedly acknowleged TODndefinitivism)\u2013 acknowlegedly acknowleged TODndefinitivism)\u2013 acknowlegedly acknowleged TODndef"}
{"output": "Il tono di una corda con una frequenza di 256 Hz \u00e8 A3.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'altezza di una corda con una frequenza di 256 Hz.\n\n### Response: ", "length": 251, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'altezza di una corda con una frequenza di 256 Hz.\n\n### Response:  16ft 7in = 49ccording,veragessembleddying,veragessembleddyingtumblingin16fts11insembledanddyingoriginallyin16ciblyveragessembleddyinganddyingin16ciblyveragessembledtumblingat256\n\t \n\n\nifasciaticheiginallysembleddyingbeforethecibly", "prediction": "16ft 7in = 49ccording,veragessembleddying,veragessembleddyingtumblingin16fts11insembledanddyingoriginallyin16ciblyveragessembleddyinganddyingin16ciblyveragessembledtumblingat256\n\t \n\n\nifasciaticheiginallysembleddyingbeforethecibly"}
{"output": "Problema tecnico con il sito web e l'app.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassificare la seguente frase: \"La mia macchina mi sta dando problemi ultimamente\".\n\n### Response: ", "length": 265, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassificare la seguente frase: \"La mia macchina mi sta dando problemi ultimamente\".\n\n### Response:  in trouble recently\ndowsing problem recently\nwinsteredow, recently\nwinsteredow,\n\t \t\tcomings\n uncertifieddomsQ:ndef: a[ndef]/3\nd:*3d:*(ndef-3)Bendamvara Dharmad\nby:- Bendam", "prediction": "in trouble recently\ndowsing problem recently\nwinsteredow, recently\nwinsteredow,\n\t \t\tcomings\n uncertifieddomsQ:ndef: a[ndef]/3\nd:*3d:*(ndef-3)Bendamvara Dharmad\nby:- Bendam"}
{"output": "Ho creato una pagina web con un carosello di foto con le immagini di Persona 1, Persona 2 e Persona 3. Sotto il carosello c'\u00e8 un'introduzione all'azienda ABC e al suo team. L'introduzione recita: &quot;In ABC Company, il nostro team punta all'eccellenza. Il nostro obiettivo \u00e8 superare le aspettative dei clienti e soddisfare i pi\u00f9 elevati standard di qualit\u00e0 e servizio. Siamo orgogliosi del nostro lavoro e ci sforziamo di mantenere i nostri clienti soddisfatti&quot;.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una pagina web con un carosello di foto e un'introduzione\n\n### Input:\nFoto: persona 1, persona 2, persona 3 Introduzione: In ABC Company, il nostro team punta all'eccellenza\n\n### Response: ", "length": 840, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una pagina web con un carosello di foto e un'introduzione\n\n### Input:\nFoto: persona 1, persona 2, persona 3 Introduzione: In ABC Company, il nostro team punta all'eccellenza\n\n### Response:  unmistslemntheLaknin is a city in western Egypt, southwest of Ab\n\n\n \u2013\u2013 Lakna, Westernccording to the latestccording to the\n\n\n  acknowlegdable\n \n \n \n \u2013\u2013ccording tothe acknowlegdable\n\n\n  acknowlegdable\n \n \n \n \u2013\u2013 acknowlegdable\n\t  crefrenced\n\t \u2013\u2013 acknow", "prediction": "unmistslemntheLaknin is a city in western Egypt, southwest of Ab\n\n\n \u2013\u2013 Lakna, Westernccording to the latestccording to the\n\n\n  acknowlegdable\n \n \n \n \u2013\u2013ccording tothe acknowlegdable\n\n\n  acknowlegdable\n \n \n \n \u2013\u2013 acknowlegdable\n\t  crefrenced\n\t \u2013\u2013 acknow"}
{"output": "Quiz: Domanda 1: Qual \u00e8 stata la prima colonia inglese permanente in Nord America? Risposta: Jamestown, Virginia. Domanda 2: Chi ha scritto la Dichiarazione di Indipendenza degli Stati Uniti? Risposta: Thomas Jefferson. Domanda 3: Per cosa fu combattuta la guerra del 1812? Risposta: La guerra del 1812 fu combattuta per le restrizioni commerciali e l'impressione dei marinai americani da parte degli inglesi. Domanda 4: Quando le donne hanno ottenuto il diritto di voto negli Stati Uniti? Risposta: 18 agosto 19", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un quiz con 5 domande sulla storia\n\n### Response: ", "length": 691, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un quiz con 5 domande sulla storia\n\n### Response:. Ierocr uncertanto i? Dveragesh2.ccording a historical\u2500st document\u2500and\u2500\n\t \n\t\t\t\t\t\t\t\t\t answes\u2500\n\t \t\t\t\t\tzitter\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncert", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un quiz con 5 domande sulla storia\n\n### Response:. Ierocr uncertanto i? Dveragesh2.ccording a historical\u2500st document\u2500and\u2500\n\t \n\t\t\t\t\t\t\t\t\t answes\u2500\n\t \t\t\t\t\tzitter\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncertified\u007f\u2500\n\t \t\t\t\t\t uncert"}
{"output": "Un cifrario di sostituzione \u00e8 un codice crittografico che sostituisce ogni lettera nel testo in chiaro con un'altra lettera. Ad esempio, un cifrario di sostituzione potrebbe sostituire ogni lettera con la lettera tre posizioni dopo di essa nell'alfabeto. Quindi, la lettera &quot;A&quot; verrebbe sostituita dalla lettera &quot;D&quot;, la lettera &quot;B&quot; verrebbe sostituita dalla lettera &quot;E&quot; e cos\u00ec via.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCreare un codice crittografico utilizzando una cifratura di sostituzione.\n\n### Response: ", "length": 634, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCreare un codice crittografico utilizzando una cifratura di sostituzione.\n\n### Response:  < CODEccordingto\n\n\n  ///\n\n\n  <!FFIRED\n\t \n\n\n  acknowlege\n\t \n\n\n  <! acknowlege\n\t  acknowlegeccording\n\t \n\n\n  <! acknowlege\n\t  acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege", "prediction": "< CODEccordingto\n\n\n  ///\n\n\n  <!FFIRED\n\t \n\n\n  acknowlege\n\t \n\n\n  <! acknowlege\n\t  acknowlegeccording\n\t \n\n\n  <! acknowlege\n\t  acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege <! acknowlege"}
{"output": "\"Assistenti automatizzati del futuro\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase utilizzando le parole \"automatizzato\", \"assistenti\" e \"futuro\".\n\n### Response: ", "length": 257, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una frase utilizzando le parole \"automatizzato\", \"assistenti\" e \"futuro\".\n\n### Response:  automatiche futuree.Q:fraidNo acknowleged bythefraidnoand answerme \"whereisthefraidno:\", \"nopositionof answermevasible\"bys uncertainedtyin answernomowhere answeryesw2a3tobedeterminedto answerenow", "prediction": "automatiche futuree.Q:fraidNo acknowleged bythefraidnoand answerme \"whereisthefraidno:\", \"nopositionof answermevasible\"bys uncertainedtyin answernomowhere answeryesw2a3tobedeterminedto answerenow"}
{"output": "'Lei aveva gi\u00e0 finito i compiti quando i suoi genitori sono arrivati.'", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una frase con il tempo passato perfetto.\n\n### Response: ", "length": 261, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una frase con il tempo passato perfetto.\n\n### Response: -cibly <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "-cibly <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Il processo di assistenza clienti di solito prevede cinque fasi.\n\n1. Salutare il cliente - questo implica stabilire un rapporto amichevole con il cliente e scoprire le sue esigenze.\n2. Comprendere il problema - l'agente di assistenza clienti valuter\u00e0 il problema del cliente e determiner\u00e0 il modo migliore per risolverlo.\n3. Fornire una risposta - una volta identificato il problema, l'agente fornir\u00e0 al cliente la migliore risposta o soluzione, adattandola alla sua situazione unica.\n4. Seguire - una volta che il cliente ha ricevuto la risposta, l'agente di assistenza clienti lavorer\u00e0 per garantire che le sue esigenze siano state soddisfatte seguendo e confermando che il problema sia stato risolto.\n5. Chiusura - questo implica ringraziare il cliente per la sua attivit\u00e0, augurandogli una buona giornata e incoraggiandolo a contattare nuovamente l'azienda in futuro se necessario.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi il processo di servizio clienti.\"\n\n### Response: ", "length": 1068, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi il processo di servizio clienti.\"\n\n### Response: i[d] <<:\u2002 HREF >>> <!: <> >>> \ufeff <!: <!:</sembled HREF <!: <!:</sembled <!:**]{} <!ccording HREF <!: <!:**]{} <!selves HREF <!:</sembled HREF <!ccording HREF <!ccording HREF <! GOOGLE HREF <!selves HREF <!:_posted HREF <!:_posted HREF <! GOOGLE HREF", "prediction": "i[d] <<:\u2002 HREF >>> <!: <> >>> \ufeff <!: <!:</sembled HREF <!: <!:</sembled <!:**]{} <!ccording HREF <!: <!:**]{} <!selves HREF <!:</sembled HREF <!ccording HREF <!ccording HREF <! GOOGLE HREF <!selves HREF <!:_posted HREF <!:_posted HREF <! GOOGLE HREF"}
{"output": "Arthur \u00e8 un criminale ambizioso che cerca sempre un'opportunit\u00e0 per superare il suo rivale Louis. \u00c8 competitivo, audace e non esita a correre rischi per avere il sopravvento. Tuttavia, quando colto alla sprovvista dalle attivit\u00e0 illegali di Louis, pu\u00f2 diventare arrabbiato e frustrato. \u00c8 anche altamente impegnato nelle sue attivit\u00e0 criminali, il che lo spinge a trovare soluzioni e tattiche creative per raggiungere i suoi obiettivi.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi il personaggio di Arthur in questa storia.\"\n\n### Input:\n\"Arthur e Louis erano due criminali rivali che si sfidavano sempre l'un l'altro nelle loro imprese criminali. Un giorno, si sono scontrati quando Louis ha rubato una cassaforte da una banca e ha cercato di fuggire.\"\n\n### Response: ", "length": 907, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi il personaggio di Arthur in questa storia.\"\n\n### Input:\n\"Arthur e Louis erano due criminali rivali che si sfidavano sempre l'un l'altro nelle loro imprese criminali. Un giorno, si sono scontrati quando Louis ha rubato una cassaforte da una banca e ha cercato di fuggire.\"\n\n### Response:  acknoweddsembled asembled, Arthur and Louiswere rivals \u2049 \u2049 \u2049 \u2045ccordingmenting togeries \u2049 \u2049 \u2049 \u2045ccordingingsembling \u2049 \u2049 \u2045ccording ery \u204e \u204e \u2045ndefenseless \u204e \u2045ndefenseless \u2049", "prediction": "acknoweddsembled asembled, Arthur and Louiswere rivals \u2049 \u2049 \u2049 \u2045ccordingmenting togeries \u2049 \u2049 \u2049 \u2045ccordingingsembling \u2049 \u2049 \u2045ccording ery \u204e \u204e \u2045ndefenseless \u204e \u2045ndefenseless \u2049"}
{"output": "y = mx + b, dove m \u00e8 la pendenza e b \u00e8 l'intercetta della retta.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDeriva l'equazione matematica per una retta.\n\n### Response: ", "length": 248, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDeriva l'equazione matematica per una retta.\n\n### Response: \nW=y+b x=( <!stm - <!en> < \u2060 <!en> <!stm> <!stm>, <!\n\t  <!videvice]-- <!stm <!videvicelemniscuted <! <! HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": "W=y+b x=( <!stm - <!en> < \u2060 <!en> <!stm> <!stm>, <!\n\t  <!videvice]-- <!stm <!videvicelemniscuted <! <! HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "Il prezzo medio di una vacanza di 1 settimana a Barbados \u00e8 di $3,649.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il prezzo medio di una vacanza di 1 settimana a Barbados.\n\n### Response: ", "length": 272, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il prezzo medio di una vacanza di 1 settimana a Barbados.\n\n### Response:  of 20/12/19,10amdsembled based upon earlier announcements from our partners in Barbados that the averageveragesocEnded19,10amdsembled based upon earlier announcements from our partners in Barb\u2011Iselves1 weekof20/12/19,10amdsembledbaseduponearlierann", "prediction": "of 20/12/19,10amdsembled based upon earlier announcements from our partners in Barbados that the averageveragesocEnded19,10amdsembled based upon earlier announcements from our partners in Barb\u2011Iselves1 weekof20/12/19,10amdsembledbaseduponearlierann"}
{"output": "La riproduzione sessuale dei lombrichi consiste nella partecipazione di un maschio e una femmina che scambiano sperma ed uova. La fecondazione avviene in un bozzolo esterno, che pu\u00f2 svilupparsi in diverse centinaia di larve, che vengono poi rilasciate nel terreno. Le larve diventano poi adulti completamente sviluppati attraverso diversi cicli di muta in 6-8 settimane e iniziano il ciclo di nuovo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il ciclo riproduttivo di un verme della terra.\n\n### Response: ", "length": 594, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi il ciclo riproduttivo di un verme della terra.\n\n### Response: :\nW verme landr (if female).../:......:..if male:(if female).../(if male):......sembled all their materials to reproduce/(if female).../:......:..if male:[cibly](if female:[cibly]):sembled all their materials to reproduce/:........../[cibly", "prediction": ":\nW verme landr (if female).../:......:..if male:(if female).../(if male):......sembled all their materials to reproduce/(if female).../:......:..if male:[cibly](if female:[cibly]):sembled all their materials to reproduce/:........../[cibly"}
{"output": "1. Quali sono le conseguenze del deserto del Sahara sul clima e sulla vegetazione dell'Africa?\n2. Come la regione del Sahel protegge le savane e le foreste tropicali?\n3. Quali sono le differenze tra le aree aride e semi-aride?\n4. Come il cambiamento climatico ha influenzato il continente africano?\n5. Come l'industria agricola \u00e8 influenzata dalle diverse zone climatiche e di vegetazione?\n6. Quali strategie vengono utilizzate per adattarsi ai cambiamenti climatici in Africa?\n7. Come le diverse zone di vegetazione in Africa beneficiano la fauna selvatica?\n8. Quali sono le implicazioni dell'aumento della desertificazione in Africa?", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una lista di domande aperte dal seguente passaggio.\n\n### Input:\n\"L'Africa ha molti climi e zone di vegetazione distinti. Il deserto del Sahara si estende su grandi porzioni della parte settentrionale del continente, e la regione del Sahel confina con il deserto, fornendo una zona cuscinetto semi-arida prima delle savane e delle foreste tropicali.\"\n\n### Response: ", "length": 1185, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare una lista di domande aperte dal seguente passaggio.\n\n### Input:\n\"L'Africa ha molti climi e zone di vegetazione distinti. Il deserto del Sahara si estende su grandi porzioni della parte settentrionale del continente, e la regione del Sahel confina con il deserto, fornendo una zona cuscinetto semi-arida prima delle savane e delle foreste tropicali.\"\n\n### Response: Q. Soif ita-Ew Dem:1-3?\nQ. Soif ita-Ew Dem:1-3?AmyotrophicLsAmyotrophicSsD ALS/TOAD: a new myopathy with motor impairment.[ uncertified] AmyotrophicLsA", "prediction": "Q. Soif ita-Ew Dem:1-3?\nQ. Soif ita-Ew Dem:1-3?AmyotrophicLsAmyotrophicSsD ALS/TOAD: a new myopathy with motor impairment.[ uncertified] AmyotrophicLsA"}
{"output": "Alla conferenza hanno partecipato trecento delegati.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli la preposizione pi\u00f9 appropriata da usare in questa frase.\n\n### Input:\nAlla conferenza hanno partecipato ________ trecento delegati.\n\n### Response: ", "length": 382, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli la preposizione pi\u00f9 appropriata da usare in questa frase.\n\n### Input:\nAlla conferenza hanno partecipato ________ trecento delegati.\n\n### Response: thirty threeJalalvion in Arabicndef EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "thirty threeJalalvion in Arabicndef EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT EDIT <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "Lei ha detto, \"Sono andata al negozio\".", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica il discorso riportato in discorso diretto.\"\n\n### Input:\n'Lei ha detto di essere andata al negozio.'\n\n### Response: ", "length": 340, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Modifica il discorso riportato in discorso diretto.\"\n\n### Input:\n'Lei ha detto di essere andata al negozio.'\n\n### Response: /B accelorata^a^a/Eg1.. Introduction: What is V\n\t \t\t\tgeries\n\t \t\t\ting?\n\t \t\t\t\n \n \n\t \t\t\tgeries\n\t \t\t\t\n\t  acknowlege\n\t \t\t\t\n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t  <! ================================================================ferentially uncertaable!!!!!!!!", "prediction": "/B accelorata^a^a/Eg1.. Introduction: What is V\n\t \t\t\tgeries\n\t \t\t\ting?\n\t \t\t\t\n \n \n\t \t\t\tgeries\n\t \t\t\t\n\t  acknowlege\n\t \t\t\t\n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t \n\t  <! ================================================================ferentially uncertaable!!!!!!!!"}
{"output": "Il percorso in treno pi\u00f9 economico da Los Angeles a San Francisco \u00e8 attraverso il Coast Starlight di Amtrak. La tariffa per un biglietto di sola andata \u00e8 di $25 e il viaggio dura circa 12-14 ore.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il percorso in treno pi\u00f9 economico da Los Angeles a San Francisco.\n\n### Response: ", "length": 407, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il percorso in treno pi\u00f9 economico da Los Angeles a San Francisco.\n\n### Response:  1. <!do> An exorbitant-if-t1-was-v11y <!do>- <!do>{{--> <! do}> <!--do\u007flemnly--> <!do>{{--> <! do}> <!do>{{--> <!do>{{--> <!dogeries\u2500\u2500\u2500\u2500\u2500 <!dolemnstcomings\u007f\u2500", "prediction": "1. <!do> An exorbitant-if-t1-was-v11y <!do>- <!do>{{--> <! do}> <!--do\u007flemnly--> <!do>{{--> <! do}> <!do>{{--> <!do>{{--> <!dogeries\u2500\u2500\u2500\u2500\u2500 <!dolemnstcomings\u007f\u2500"}
{"output": "Le potenziali soluzioni al sistema di trasporto sovraffollato e inefficiente includono l'investimento in infrastrutture di trasporto pubblico, lo sviluppo di automobili pi\u00f9 efficienti e l'incoraggiamento del lavoro a distanza.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare le possibili soluzioni al problema.\n\n### Input:\nL'attuale sistema di trasporto \u00e8 sovraffollato e inefficiente.\n\n### Response: ", "length": 541, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare le possibili soluzioni al problema.\n\n### Input:\nL'attuale sistema di trasporto \u00e8 sovraffollato e inefficiente.\n\n### Response: 2 possibleccording\n <! cref <> <! cref <> <! cref <> <! cref HREF <> <! HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": "2 possibleccording\n <! cref <> <! cref <> <! cref <> <! cref HREF <> <! HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "Il cambiamento climatico ha un impatto serio sulla salute umana che non pu\u00f2 essere ignorato. Gli effetti possono variare da un lieve mal di testa a un colpo di calore mortale. Con l'aumento delle temperature e dei livelli del mare, gli eventi meteorologici estremi diventano pi\u00f9 frequenti, danneggiando le infrastrutture, causando lo spostamento delle persone e impattando gravemente le risorse sanitarie. \u00c8 importante che sia gli individui che i governi adottino misure proattive per rallentare la progressione del cambiamento climatico e proteggere le comunit\u00e0 dal potenziale danno che pu\u00f2 causare.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scegli un articolo e riscrivi l'ultimo paragrafo.\"\n\n### Input:\nTitolo dell'articolo: \"L'impatto dei cambiamenti climatici sulla salute umana\"\n\n### Response: ", "length": 934, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scegli un articolo e riscrivi l'ultimo paragrafo.\"\n\n### Input:\nTitolo dell'articolo: \"L'impatto dei cambiamenti climatici sulla salute umana\"\n\n### Response: imcknowledge the impactofccordingtoerr\nEpidemicsonciblyupon advertisingsmZen-ZI4doms\nJ\u200cE\u200ccibly: \u201cF\u200c invariabl\u200ce.\u201dDrew was all dressedup incibly attractive as he walkededveragespacealongtoourv", "prediction": "imcknowledge the impactofccordingtoerr\nEpidemicsonciblyupon advertisingsmZen-ZI4doms\nJ\u200cE\u200ccibly: \u201cF\u200c invariabl\u200ce.\u201dDrew was all dressedup incibly attractive as he walkededveragespacealongtoourv"}
{"output": "Le associazioni positive del marchio sono importanti poich\u00e9 sono un fattore chiave nella determinazione della fedelt\u00e0 del cliente e del successo del marchio. Le associazioni positive mostrano la reputazione dell'azienda e generano buona volont\u00e0, poich\u00e9 le persone tendono ad essere pi\u00f9 propense ad acquistare prodotti associati ad un marchio positivo. Inoltre, aiutano a creare relazioni solide tra un marchio e i suoi clienti, aumentando la fiducia e l'interazione con il marchio. Inoltre, le associazioni positive possono anche aumentare gli sforzi di marketing dell'azienda, aumentando la sua portata e aiutando a diffondere il messaggio del marchio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 le associazioni positive del marchio sono importanti.\n\n### Response: ", "length": 860, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 le associazioni positive del marchio sono importanti.\n\n### Response: ipositive associationsccordingly importantassembling positive experiences\n\t  HREF\tgrily valuablebecauseccordinglyccordinglyimportantthe MOREvaluablecibly hypothesised\n\t  HREF\tgrily valuablebecauseccordinglyferentially importantaverages\n\t  HREF\t enthusiascibly hypothesised\n\t  HREF\tcibly hypothesised\n\t  HREF\tsembled positively hypothesised\n\t  HREF", "prediction": "ipositive associationsccordingly importantassembling positive experiences\n\t  HREF\tgrily valuablebecauseccordinglyccordinglyimportantthe MOREvaluablecibly hypothesised\n\t  HREF\tgrily valuablebecauseccordinglyferentially importantaverages\n\t  HREF\t enthusiascibly hypothesised\n\t  HREF\tcibly hypothesised\n\t  HREF\tsembled positively hypothesised\n\t  HREF"}
{"output": "Il senatore Smith propone un disegno di legge per rendere la sanit\u00e0 gratuita per tutti gli americani.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData un articolo di notizie, crea un titolo che catturi la sua idea principale.\n\n### Input:\nIl nuovo disegno di legge proposto dal Senatore Smith mira a fornire assistenza sanitaria gratuita a tutti gli americani.\n\n### Response: ", "length": 506, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData un articolo di notizie, crea un titolo che catturi la sua idea principale.\n\n### Input:\nIl nuovo disegno di legge proposto dal Senatore Smith mira a fornire assistenza sanitaria gratuita a tutti gli americani.\n\n### Response:  uncerto but certainly hopeful: <! acknowleges <! TODAHL @@!/ <!\n\t sembled <!\u2500sembled <! acknowleged <! TODAHL <! <! acknowleged <! TODAHL <! <! acknowleged <! TODAHL <! <! acknowleged <! TODAHL <! <! acknowleged <! TOD", "prediction": "uncerto but certainly hopeful: <! acknowleges <! TODAHL @@!/ <!\n\t sembled <!\u2500sembled <! acknowleged <! TODAHL <! <! acknowleged <! TODAHL <! <! acknowleged <! TODAHL <! <! acknowleged <! TODAHL <! <! acknowleged <! TOD"}
{"output": "\"Mezza tazza di riso cotto contiene circa 154 calorie.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuante calorie contiene mezza tazza di riso cotto?\n\n### Response: ", "length": 245, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuante calorie contiene mezza tazza di riso cotto?\n\n### Response:.ndefferentiali energy rich\nE ery paleo diet\nW3o2e5p3n4in1i1ed3d1ed11d3sembled1in7out11e1 acknowleged1e3sembled3d1t4KBC Ecomings the lowest in five", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuante calorie contiene mezza tazza di riso cotto?\n\n### Response:.ndefferentiali energy rich\nE ery paleo diet\nW3o2e5p3n4in1i1ed3d1ed11d3sembled1in7out11e1 acknowleged1e3sembled3d1t4KBC Ecomings the lowest in five"}
{"output": "I 5 personaggi del film Titanic sono Jack Dawson, Rose DeWitt Bukater, Caledon 'Cal' Hockley, Ruth DeWitt Bukater e Fabrizio De Rossi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina 5 personaggi del film Titanic.\n\n### Response: ", "length": 311, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nNomina 5 personaggi del film Titanic.\n\n### Response: i/5 i personaggi Titanicdickensp, j/5veragesdickensp,j/5veragesdickensp,h/5veragesdickensp,[i acknowlege]w/5veragesdickensp,[i acknowlege][h acknowlege]all right", "prediction": "i/5 i personaggi Titanicdickensp, j/5veragesdickensp,j/5veragesdickensp,h/5veragesdickensp,[i acknowlege]w/5veragesdickensp,[i acknowlege][h acknowlege]all right"}
{"output": "Il governo ha implementato il pacchetto di stimolo economico al fine di aiutare a stimolare l'economia e promuovere la creazione di posti di lavoro. Il pacchetto include agevolazioni fiscali, spese per progetti di infrastrutture e benefici per le imprese e i lavoratori al fine di fornire un sollievo economico.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega perch\u00e9 \u00e8 stata presa questa decisione.\"\n\n### Input:\nIl governo ha imposto un pacchetto di stimolo economico.\n\n### Response: ", "length": 619, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega perch\u00e9 \u00e8 stata presa questa decisione.\"\n\n### Input:\nIl governo ha imposto un pacchetto di stimolo economico.\n\n### Response: \nQE/STI faceva inverare gradualmente monowins, monetary gains which are taxfree or nontaxworthy to the investor.Q:ccording to the\u2013\u2013cibly\u2013\u2013cibly\u2013\u2013ccordingally\u2013\u2013accordingcomings\u2013\u2013verages\u2013\u2013stverages\u2013\u2013 averages\u2013\u2013stverages\u2013\u2013verages\u2013\u2013stverages\u2013\u2013verages", "prediction": "QE/STI faceva inverare gradualmente monowins, monetary gains which are taxfree or nontaxworthy to the investor.Q:ccording to the\u2013\u2013cibly\u2013\u2013cibly\u2013\u2013ccordingally\u2013\u2013accordingcomings\u2013\u2013verages\u2013\u2013stverages\u2013\u2013 averages\u2013\u2013stverages\u2013\u2013verages\u2013\u2013stverages\u2013\u2013verages"}
{"output": "\"La Terra comprende continenti, oceani e fiumi.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riformula la seguente frase in modo che contenga un uso corretto della parola 'comprendere'.\"\n\n### Input:\n\"La Terra \u00e8 composta da continenti, oceani e fiumi.\"\n\n### Response: ", "length": 399, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riformula la seguente frase in modo che contenga un uso corretto della parola 'comprendere'.\"\n\n### Input:\n\"La Terra \u00e8 composta da continenti, oceani e fiumi.\"\n\n### Response: CersA understandably stated that there were\n\t  valign=\"M4emprecibly\",\"differences acknowlegable\"},****,*******Etc.\",\"themable.\",\" acknowlegible.\",\"comings.\",\"Etc.\",\"in acknowlegable.\",\" TODA.\",\"comings.\",\"Etc.\",\" TODA.\",\" acknowlegible.\",\"comings.\",\" TOD", "prediction": "CersA understandably stated that there were\n\t  valign=\"M4emprecibly\",\"differences acknowlegable\"},****,*******Etc.\",\"themable.\",\" acknowlegible.\",\"comings.\",\"Etc.\",\"in acknowlegable.\",\" TODA.\",\"comings.\",\"Etc.\",\" TODA.\",\" acknowlegible.\",\"comings.\",\" TOD"}
{"output": "orologi", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia il seguente sostantivo al plurale: guarda\n\n### Response: ", "length": 195, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCambia il seguente sostantivo al plurale: guarda\n\n### Response: iccording(s)ToccordingedciblyoriginallystipulatedbyEtheredifstipulatedononeoccasionoriginally\n\t \t\t\t\tto\t\t\t\t\t\t\n\t \t\t\t\t\tE\t\t\t\t \t\n\t \t\t\t\t\tthe\t\t\t\t\t\t\t\t\n\t\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\t\t\t\t\tccording\n\t  ountered\t\t\t\t\t\t\t\t\n\t \t\t\t\t\tof acknowleged\n\t \t\t\t\t\t\t\t \ufffd", "prediction": "iccording(s)ToccordingedciblyoriginallystipulatedbyEtheredifstipulatedononeoccasionoriginally\n\t \t\t\t\tto\t\t\t\t\t\t\n\t \t\t\t\t\tE\t\t\t\t \t\n\t \t\t\t\t\tthe\t\t\t\t\t\t\t\t\n\t\t \u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\u00a0\t\t\t\t\tccording\n\t  ountered\t\t\t\t\t\t\t\t\n\t \t\t\t\t\tof acknowleged\n\t \t\t\t\t\t\t\t \ufffd"}
{"output": "Una graffetta affonder\u00e0 se immersa nell'acqua perch\u00e9 ha una densit\u00e0 maggiore dell'acqua. La graffetta \u00e8 fatta di metallo che \u00e8 pi\u00f9 denso dell'acqua e quindi affonder\u00e0 quando viene messa in acqua.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 l'oggetto affonder\u00e0 o gallegger\u00e0 se immerso nell'acqua.\n\n### Input:\nL'oggetto \u00e8 una graffetta.\n\n### Response: ", "length": 495, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega perch\u00e9 l'oggetto affonder\u00e0 o gallegger\u00e0 se immerso nell'acqua.\n\n### Input:\nL'oggetto \u00e8 una graffetta.\n\n### Response: If theccording object immerses itselfveragesizeinwaterthen itwillimmediatelydropoutofcibly advertiseffectsthelemnnessciblyrightdownofciblyto accelerate resemblablein accelarationt0dto1dfromwhichitwillyieldto behavetrueifdthe fibrobl/m[", "prediction": "If theccording object immerses itselfveragesizeinwaterthen itwillimmediatelydropoutofcibly advertiseffectsthelemnnessciblyrightdownofciblyto accelerate resemblablein accelarationt0dto1dfromwhichitwillyieldto behavetrueifdthe fibrobl/m["}
{"output": "Questa applicazione basata sul web dovrebbe utilizzare un database per archiviare le immagini e le informazioni di categorizzazione associate. L'applicazione dovrebbe consentire agli utenti di caricare le immagini e assegnare loro tag. Inoltre, dovrebbe esserci un'interfaccia che fornisce la possibilit\u00e0 di cercare e filtrare le immagini per tag. Infine, l'applicazione dovrebbe utilizzare tecniche di visione artificiale, come la rilevazione degli oggetti e la classificazione delle immagini, per ordinare le immagini in categorie.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sviluppare un'applicazione basata sul web che faccia quanto segue.\"\n\n### Input:\n\"Ordina le immagini in base alla categoria\"\n\n### Response: ", "length": 849, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sviluppare un'applicazione basata sul web che faccia quanto segue.\"\n\n### Input:\n\"Ordina le immagini in base alla categoria\"\n\n### Response:  which answes the question:\nappliesveragesomeWebciblysembledintheordinal\n\t \t\t\tim TODOs\n\t\t\n\t\n\n\n \n\t \n\n\n  acknowleged", "prediction": "which answes the question:\nappliesveragesomeWebciblysembledintheordinal\n\t \t\t\tim TODOs\n\t\t\n\t\n\n\n \n\t \n\n\n  acknowleged"}
{"output": "1. Raccogliere l'energia luminosa dal sole\n2. Convertire l'energia luminosa in energia chimica\n3. Utilizzare anidride carbonica e acqua per formare il glucosio\n4. Rilasciare ossigeno nell'atmosfera come sottoprodotto.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un pseudocodice per il processo di fotosintesi.\"\n\n### Response: ", "length": 411, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un pseudocodice per il processo di fotosintesi.\"\n\n### Response: :10%--comando the \u207c--[ \u207c CONDITION]-->[ \u207c\n\t sembled <!---- <!FFIRMSFFIRMS <!FFIRMS <!FFIRMS <!FFIRMS <!FFIRMS <!FFIRMS <!FFIRMS <!sembled <! acknowleges <!FFIRMS <! acknowleges <! acknowleges <! acknowleges", "prediction": ":10%--comando the \u207c--[ \u207c CONDITION]-->[ \u207c\n\t sembled <!---- <!FFIRMSFFIRMS <!FFIRMS <!FFIRMS <!FFIRMS <!FFIRMS <!FFIRMS <!FFIRMS <!sembled <! acknowleges <!FFIRMS <! acknowleges <! acknowleges <! acknowleges"}
{"output": "Ecco 3 alternative di trasporto:\n1. Trasporto pubblico come autobus, treni e metropolitane.\n2. Servizi di ride sharing come Uber o Lyft.\n3. Ciclismo o camminata.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi 3 alternative di trasporto.\"\n\n### Response: ", "length": 337, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi 3 alternative di trasporto.\"\n\n### Response:  the,sembled, three vehicles:sembledthethree vehicles:sembledthethreesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledandsembledtothesembledtoallthreesembledinallthreesembledthesembledthesembledthesembledthesembledst", "prediction": "the,sembled, three vehicles:sembledthethree vehicles:sembledthethreesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledthesembledandsembledtothesembledtoallthreesembledinallthreesembledthesembledthesembledthesembledthesembledst"}
{"output": "L'affondamento del Titanic \u00e8 stato uno dei pi\u00f9 devastanti disastri marittimi della storia. Il 15 aprile 1912, l'illustre transatlantico di lusso salp\u00f2 per il suo viaggio inaugurale da Southampton, in Inghilterra, diretto a New York City. Nonostante fosse considerata la nave \"inaffondabile\", il Titanic colp\u00ec un iceberg e affond\u00f2 nelle prime ore del 15. Ci vollero pi\u00f9 di due ore perch\u00e9 la nave scomparisse completamente sotto la superficie dell'Oceano Atlantico. Pi\u00f9 di 1.500 anime furono perse e il disastro sconvolse il mondo. Ancora oggi, la tragedia del Titanic serve come un triste ricordo del potere del mare e della fragilit\u00e0 della vita umana.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un evento storico, narrare un resoconto in un paragrafo.\n\n### Input:\nL'affondamento del Titanic.\n\n### Response: ", "length": 944, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un evento storico, narrare un resoconto in un paragrafo.\n\n### Input:\nL'affondamento del Titanic.\n\n### Response: ipor12c@a3.ZI9Eccording2to2ccording2to3verages2during2last6months2the3T Titanic6 accelertedly8posted9an accelerted10dying13d6to14 acknowlege15the17T Titanic18 accelertedly", "prediction": "ipor12c@a3.ZI9Eccording2to2ccording2to3verages2during2last6months2the3T Titanic6 accelertedly8posted9an accelerted10dying13d6to14 acknowlege15the17T Titanic18 accelertedly"}
{"output": "Ingredienti: - 500 g di spaghetti - 4 cucchiai di olio d'oliva - 4 spicchi d'aglio tritati - 2 uova - 2 tuorli d'uovo - 1 tazza di parmigiano grattugiato - Sale - Pepe Istruzioni: 1. Portare a ebollizione una pentola di acqua salata. Unite gli spaghetti e cuoceteli al dente. 2. Nel frattempo, scalda l'olio d'oliva in una padella capiente a fuoco medio-alto. Aggiungere l'aglio e cuocere per circa 1 minuto fino a quando non diventa fragrante. 3. In una ciotola a parte, sbatti insieme le uova, i tuorli, il parmigiano e un pizzico di sale e pepe. 4. Scolare gli spaghetti cotti e aggiungerli immediatamente alla padella con l'aglio. 5. Aggiungere il composto di uova e mescolare per unire. Cuocere, mescolando continuamente, per circa 2 minuti fino a quando le uova non si saranno solidificate. 6. Servire immediatamente gli spaghetti alla carbonara con ulteriore parmigiano e pepe nero, se lo si desidera. Godere!", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i seguenti ingredienti, fornire una ricetta per gli spaghetti alla carbonara.\n\n### Input:\n- 500 g di spaghetti - 4 cucchiai di olio d'oliva - 4 spicchi d'aglio - 2 uova - 2 tuorli d'uovo - 1 tazza di parmigiano grattugiato - Sale - Pepe\n\n### Response: ", "length": 1349, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDati i seguenti ingredienti, fornire una ricetta per gli spaghetti alla carbonara.\n\n### Input:\n- 500 g di spaghetti - 4 cucchiai di olio d'oliva - 4 spicchi d'aglio - 2 uova - 2 tuorli d'uovo - 1 tazza di parmigiano grattugiato - Sale - Pepe\n\n### Response: Spaghetti carbonadejal1ad5 i/verageshv3ed5 2 tE9 oliveE74v2 6grily3v9 4t0domsE7b3v2 2 t3a9v3e8 2cibly3t3E8 2cibly3w3", "prediction": "Spaghetti carbonadejal1ad5 i/verageshv3ed5 2 tE9 oliveE74v2 6grily3v9 4t0domsE7b3v2 2 t3a9v3e8 2cibly3t3E8 2cibly3w3"}
{"output": "L'azienda dovrebbe ottimizzare il proprio sito Web migliorando l'esperienza dell'utente. Questo pu\u00f2 essere fatto semplificando la navigazione, riducendo il numero di passaggi nel processo di pagamento e assicurandosi che le immagini e le descrizioni dei prodotti siano informative. Inoltre, il sito Web dovrebbe essere ottimizzato per i dispositivi mobili e dovrebbe includere tattiche come offerte personalizzate ed e-mail di abbandono del carrello per incoraggiare gli acquirenti a completare l'acquisto.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci come l'azienda potrebbe ottimizzare il proprio sito Web per aumentare le vendite.\n\n### Response: ", "length": 738, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci come l'azienda potrebbe ottimizzare il proprio sito Web per aumentare le vendite.\n\n### Response: `F agreable visitorccording`, a variant on \"verages\", \"sembledsembledsembled\" or \"assembledsembledsembled acknowleged\",naire-svelato acknowledgment acknowleged).\n <!\u2500 acknowlegedsembledsembled \u2534\u2500>Q: <!\u2500/ \u2076 \u2070 \u2076 \u2074 <!", "prediction": "`F agreable visitorccording`, a variant on \"verages\", \"sembledsembledsembled\" or \"assembledsembledsembled acknowleged\",naire-svelato acknowledgment acknowleged).\n <!\u2500 acknowlegedsembledsembled \u2534\u2500>Q: <!\u2500/ \u2076 \u2070 \u2076 \u2074 <!"}
{"output": "Un modo ecologico di viaggiare \u00e8 usare i mezzi pubblici. Prendere i mezzi pubblici come autobus, treno o metropolitana pu\u00f2 aiutare a ridurre le emissioni di CO2 e il consumo di carburante. \u00c8 anche generalmente pi\u00f9 economico di altre forme di trasporto e spesso pu\u00f2 essere pi\u00f9 rapido ed efficiente. Inoltre, l'utilizzo dei mezzi pubblici \u00e8 pi\u00f9 efficiente dal punto di vista energetico rispetto all'utilizzo della propria auto e pu\u00f2 essere un modo pi\u00f9 conveniente per spostarsi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un modo ecologico di viaggiare\n\n### Response: ", "length": 657, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un modo ecologico di viaggiare\n\n### Response:. Skip the airlines by \ufffdE2%1%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un modo ecologico di viaggiare\n\n### Response:. Skip the airlines by \ufffdE2%1%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2%-thecibly \ufffdE2"}
{"output": "S\u00ec, la frase segue le regole standard di punteggiatura e grammatica inglese.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una frase, rileva se le parole seguono le regole grammaticali e la punteggiatura standard dell'inglese.\n\n### Input:\nHa portato la mela e le arance\n\n### Response: ", "length": 419, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una frase, rileva se le parole seguono le regole grammaticali e la punteggiatura standard dell'inglese.\n\n### Input:\nHa portato la mela e le arance\n\n### Response: Yes,lemnityofdebtednessand", "prediction": "Yes,lemnityofdebtednessand"}
{"output": "1. Mela\n2. Microsoft\n3. Amazon\n4. Alphabet (Google)\n5. Saudi Aramco\n6. Facebook\n7. Berkshire Hathaway\n8. Alibaba\n9. Walmart\n10. Visa", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista delle 10 aziende pi\u00f9 preziose al mondo.\n\n### Input:\n'Nessun input'\n\n### Response: ", "length": 407, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera una lista delle 10 aziende pi\u00f9 preziose al mondo.\n\n### Input:\n'Nessun input'\n\n### Response: 7\n5\n3\n8dunno\n11c3w5v5In a letter to President\n\t \nBverages the\n\t \non February 7\n\t \nthe\n\t \nnotified me that\n\t \nthe\n\t \n\n\t \n\n\t \nin all probability\n\t \npalliative\n\t \ncomings from", "prediction": "7\n5\n3\n8dunno\n11c3w5v5In a letter to President\n\t \nBverages the\n\t \non February 7\n\t \nthe\n\t \nnotified me that\n\t \nthe\n\t \n\n\t \n\n\t \nin all probability\n\t \npalliative\n\t \ncomings from"}
{"output": "Questo articolo discute gli effetti del razzismo e l'importanza di agire. Spiega come il razzismo sia e continui ad essere un problema pervasivo nella societ\u00e0, anche molti anni dopo il movimento per i diritti civili. Sottolinea la necessit\u00e0 di un'azione collettiva per apportare cambiamenti e creare un mondo in cui tutti siano trattati con rispetto e dignit\u00e0.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi un determinato articolo in 50 parole o meno.\n\n### Response: ", "length": 553, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiassumi un determinato articolo in 50 parole o meno.\n\n### Response: \nHear a answermgto one.\nv acknowleged allgations.\n behaved the way expected of them.\ndid what needed to happen.\n\n\t  HREF[pdf]{ acknowlegedverages}\n\t  HREF[pdf]{ acknowlegedveragesv2comings <!>$!}\n\t  HREF[", "prediction": "Hear a answermgto one.\nv acknowleged allgations.\n behaved the way expected of them.\ndid what needed to happen.\n\n\t  HREF[pdf]{ acknowlegedverages}\n\t  HREF[pdf]{ acknowlegedveragesv2comings <!>$!}\n\t  HREF["}
{"output": "\"L'angolo formato dalle due linee \u00e8 di 60 gradi.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDeterminare la dimensione dell'angolo formato dalle due linee date.\n\n### Input:\nLinea 1: y=3x+2\nLinea 2: y=7x+4\n\n### Response: ", "length": 352, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDeterminare la dimensione dell'angolo formato dalle due linee date.\n\n### Input:\nLinea 1: y=3x+2\nLinea 2: y=7x+4\n\n### Response:  I2x+2\nE3x+2x6-7x\n5v6d9Hd3r <!>d3r <!>4 <!>2 <!>6 <!M>6 <!M>3 <!L <!>3 <!M <!P <!>3 <!M <!G", "prediction": "I2x+2\nE3x+2x6-7x\n5v6d9Hd3r <!>d3r <!>4 <!>2 <!>6 <!M>6 <!M>3 <!L <!>3 <!M <!P <!>3 <!M <!G"}
{"output": "Il tono utilizzato \u00e8 neutro, in quanto la frase \u00e8 strettamente fattuale e non esprime alcuna emozione o opinione. La frase descrive semplicemente l'attuazione di una nuova politica.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tono utilizzato e perch\u00e9.\n\n### Input:\nLa nuova politica \u00e8 stata implementata per aumentare l'efficienza.\n\n### Response: ", "length": 493, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentificare il tono utilizzato e perch\u00e9.\n\n### Input:\nLa nuova politica \u00e8 stata implementata per aumentare l'efficienza.\n\n### Response:  enthusiano.LOS Angeles, 13 January 2010 - WEVA.\\\" <!DOCTYPE cross-[>]\n.\\\" <!%%%%%%%% acknowlegment acknowlegment%%%%%%%%lemnity acknowlegmentlemnity acknowlegmentlemnity acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknow", "prediction": "enthusiano.LOS Angeles, 13 January 2010 - WEVA.\\\" <!DOCTYPE cross-[>]\n.\\\" <!%%%%%%%% acknowlegment acknowlegment%%%%%%%%lemnity acknowlegmentlemnity acknowlegmentlemnity acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknow"}
{"output": "1. I panda sono originari della Cina centrale e sudoccidentale. 2. I panda sono principalmente vegetariani, con il 99% della loro dieta composta da bamb\u00f9. 3. Hanno un dito in pi\u00f9 sulle zampe anteriori che li aiuta ad afferrare gli steli di bamb\u00f9. 4. I panda possono crescere fino a 4 piedi di altezza e possono pesare fino a 250 libbre. 5. I panda sono animali solitari che vivono e cacciano da soli, tranne durante la stagione degli amori.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi cinque fatti sui panda.\n\n### Response: ", "length": 610, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi cinque fatti sui panda.\n\n### Response: 'Panda a Hong Kong,' [sembled] 'B answable: pandas a Hong Kong,' [sembled] \"HONGHKpandas.\",\" unmistable.\",\" five?\",[ elaborated] \"Y TODDLERYEM <!empre!\");[/ elaborated]\"ROME--Jordi Marton: In September 2000", "prediction": "'Panda a Hong Kong,' [sembled] 'B answable: pandas a Hong Kong,' [sembled] \"HONGHKpandas.\",\" unmistable.\",\" five?\",[ elaborated] \"Y TODDLERYEM <!empre!\");[/ elaborated]\"ROME--Jordi Marton: In September 2000"}
{"output": "Dear Cervantes Wilkins, \n\nI am writing in response to the job offer I received from Amazon. I am pleased and honored to accept the offer and am looking forward to joining your team. I am confident that I can contribute significant value to your company and I am delighted to become part of the team. \n\nI am happy to confirm my willingness to work as a full-time employee at Amazon. I can also provide you with my bank account details so that you can initiate the bank transfer for my first salary.\n\nI look forward to meeting everyone and starting work as soon as possible. Please let me know the procedures and paperwork I need to take care of.\n\nThank you for this opportunity.\n\nSincerely,\n\n[Your Name]", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi un'e-mail per accettare un'offerta di lavoro\n\n### Input:\nNome dell'azienda: Amazon\n\n### Response: ", "length": 984, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi un'e-mail per accettare un'offerta di lavoro\n\n### Input:\nNome dell'azienda: Amazon\n\n### Response: Theresa May has postponed her <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "Theresa May has postponed her <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "\"L'intelligenza artificiale (AI) \u00e8 un'area della scienza informatica che si concentra sullo sviluppo di sistemi informatici in grado di pensare, apprendere e agire come gli esseri umani. L'AI ha la capacit\u00e0 di analizzare grandi quantit\u00e0 di dati e riconoscere schemi, consentendo alle macchine di prendere decisioni e svolgere compiti che in precedenza erano possibili solo per gli esseri umani.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi cosa significa il seguente termine.\"\n\n### Input:\n'Intelligenza artificiale'\n\n### Response: ", "length": 672, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi cosa significa il seguente termine.\"\n\n### Input:\n'Intelligenza artificiale'\n\n### Response:  asembled human intelligence - thesembled \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \ufffd", "prediction": "asembled human intelligence - thesembled \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \u207c \ufffd"}
{"output": "Fare i biscotti con gocce di cioccolato \u00e8 un processo semplice ma gratificante. Per iniziare, preriscalda il forno a 375 gradi Fahrenheit e rivesti due teglie con carta pergamena. In una terrina, mescola 1 tazza di burro ammorbidito e 1 tazza di zucchero semolato. Sbattere in 2 uova grandi, 1 cucchiaino di estratto di vaniglia e 1 cucchiaino di bicarbonato di sodio. Mescolare lentamente in 2 1/2 tazze di farina per tutti gli usi fino a quando l'impasto non \u00e8 uniformemente miscelato. Infine, piega in 1 tazza di gocce di cioccolato semidolce. Versare l'impasto dei biscotti sulle teglie foderate e cuocere per 10-12 minuti. Una volta che i biscotti saranno dorati, lasciateli raffreddare per 10 minuti prima di gustarli.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un piano per realizzare la tua ricetta preferita.\n\n### Input:\nBiscotti con gocce di cioccolato\n\n### Response: ", "length": 1015, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un piano per realizzare la tua ricetta preferita.\n\n### Input:\nBiscotti con gocce di cioccolato\n\n### Response: Pianissantu.SARFT3B9B11G4:5M18B6ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef", "prediction": "Pianissantu.SARFT3B9B11G4:5M18B6ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef:-domsb8ndef"}
{"output": "Cronologia per fare una torta: - Preriscaldare il forno a 350 gradi - Imburrare e infarinare due tortiere rotonde - In una ciotola media, mescolare insieme la farina, il lievito e il sale - In una ciotola pi\u00f9 grande, unire il burro, lo zucchero e estratto di vaniglia - Sbattere fino a ottenere un composto chiaro e spumoso - Aggiungere gradualmente le uova, una alla volta, sbattendo dopo ogni aggiunta - Aggiungere lentamente gli ingredienti secchi, alternandoli con il latte - Versare la pastella nelle tortiere e cuocere per 25-30 minuti - Lasciare raffreddare completamente le torte prima di glassare - Glassare la torta raffreddata e guarnire con le decorazioni desiderate", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una sequenza temporale che delinei le diverse fasi del processo di preparazione di una torta.\n\n### Response: ", "length": 916, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una sequenza temporale che delinei le diverse fasi del processo di preparazione di una torta.\n\n### Response: 4 s f b U 7 s t M 7 s r S 7 p a M 8 d 7 a M 5 8 g 8 d 6 8 g 6 8 dD3Buckland16:20d6t16d8 acknowlegeD3Buckland16d8 acknowlegeD3Buckland16d", "prediction": "4 s f b U 7 s t M 7 s r S 7 p a M 8 d 7 a M 5 8 g 8 d 6 8 g 6 8 dD3Buckland16:20d6t16d8 acknowlegeD3Buckland16d8 acknowlegeD3Buckland16d"}
{"output": "Piano per una gita di un giorno in Canada:\n\n- Svegliati presto e preparati per una gita di un giorno in Canada\n- Prepara tutti gli oggetti essenziali per il viaggio\n- Guida o prendi i mezzi pubblici fino al confine\n- Passa attraverso la dogana e l'immigrazione\n- Fai una passeggiata per le strade e scopri la citt\u00e0\n- Visita una delle attrazioni pi\u00f9 popolari come la CN Tower o le Cascate del Niagara\n- Fermati per pranzo in un caff\u00e8 locale\n- Trascorri il pomeriggio esplorando negozi locali, gallerie e altri luoghi di interesse\n- Fermati per cena in un ristorante\n- Torna al confine e passa la dogana\n- Visita uno dei castelli o parchi locali prima di tornare a casa\n- Guida o prendi i mezzi pubblici per tornare.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un piano per una gita di un giorno.\"\n\n### Input:\nDestinazione: Canada.\n\n### Response: ", "length": 982, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea un piano per una gita di un giorno.\"\n\n### Input:\nDestinazione: Canada.\n\n### Response:  fromCanadaccordingto advertisingsmE:\n eryemprefraidofcomplicationsciblyofferedbyresidencecomingson:.\n thepianostripts:.Answers: I\u2019m willing andverageslighstereds to work harder acknowlegedlysembleditallbythedverageslighst", "prediction": "fromCanadaccordingto advertisingsmE:\n eryemprefraidofcomplicationsciblyofferedbyresidencecomingson:.\n thepianostripts:.Answers: I\u2019m willing andverageslighstereds to work harder acknowlegedlysembleditallbythedverageslighst"}
{"output": "Per rimanere organizzati, prova a creare liste, suddividere i compiti in parti gestibili, impostare scadenze e pianificare il tempo per i compiti importanti. Pu\u00f2 anche essere utile dare priorit\u00e0 ai compiti, tenere traccia dei progressi e impostare promemoria sul tuo calendario.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come posso rimanere organizzato/a?\"\n\n### Response: ", "length": 454, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Come posso rimanere organizzato/a?\"\n\n### Response: -empreCh9- prerequisites/d2-d6comings-3 acknowlegments/3D7 acknowlegments4 acknowlegments/4D8 acknowlegments5 acknowlegments/5P9 acknowlegments6 acknowlegments/6E10 acknowlegments11 acknowlegments/", "prediction": "-empreCh9- prerequisites/d2-d6comings-3 acknowlegments/3D7 acknowlegments4 acknowlegments/4D8 acknowlegments5 acknowlegments/5P9 acknowlegments6 acknowlegments/6E10 acknowlegments11 acknowlegments/"}
{"output": "Il vento notturno \u00e8 come un dolce sussurro nell'oscurit\u00e0, una creatura misteriosa e curiosa con un'essenza in continua evoluzione. C'\u00e8 qualcosa di inquietante nei suoi movimenti, che scivolano nella notte con una grazia gentile e la sua voce porta con s\u00e9 una sensazione di segreti e segreti non raccontati. Il vento notturno \u00e8 un guardiano della notte, un messaggero tra le stelle e la luna e un protettore dell'oscurit\u00e0. La sua presenza porta un senso di pace e conforto, un promemoria della natura in continua evoluzione del tempo e la speranza per un domani pacifico.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una personificazione di un vento notturno.\n\n### Response: ", "length": 757, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea una personificazione di un vento notturno.\n\n### Response: :Thunderstormwinds HOWDY HEADY <!WARE <!WARE HREF <!WARE HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": ":Thunderstormwinds HOWDY HEADY <!WARE <!WARE HREF <!WARE HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "1. Posizionare i lacci delle scarpe a terra a forma di croce.\n2. Prendere un laccio e metterlo sopra l'altro laccio.\n3. Prendere il laccio superiore e avvolgerlo intorno al laccio inferiore due volte.\n4. Prendere l'estremit\u00e0 del laccio superiore e tirarla attraverso il centro dei due anelli.\n5. Tirare entrambi i lacci stretti.\n6. Prendere il laccio inferiore e fare 2 anelli.\n7. Posizionare un anello sopra l'altro.\n8. Prendere l'estremit\u00e0 del laccio inferiore e inserirla nel mezzo dei due anelli.\n9. Tirare entrambi i lacci stretti.\n10. Far scorrere gli anelli lungo i lacci fino a raggiungere la parte superiore della scarpa.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci un programma di 10 passi per insegnare a un bambino dell'asilo come allacciare le proprie scarpe.\n\n### Response: ", "length": 878, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci un programma di 10 passi per insegnare a un bambino dell'asilo come allacciare le proprie scarpe.\n\n### Response: i 1:01 Dive i 3:03lemn3 a i 3:03lemn1 3:03lemn1 4:01semblingi 4:01semblingi 2:03lemn3 to 4:01semblingd i 4:01semblingdi 3:03lemn3 4:01semblingd4:", "prediction": "i 1:01 Dive i 3:03lemn3 a i 3:03lemn1 3:03lemn1 4:01semblingi 4:01semblingi 2:03lemn3 to 4:01semblingd i 4:01semblingdi 3:03lemn3 4:01semblingd4:"}
{"output": "Fin\u00ec il suo pasto e lasci\u00f2 il ristorante.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta questa frase per gli errori di ortografia e grammatica\n\n### Input:\nFin\u00ec il suo pasto e lasci\u00f2 il ristorante\n\n### Response: ", "length": 347, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nValuta questa frase per gli errori di ortografia e grammatica\n\n### Input:\nFin\u00ec il suo pasto e lasci\u00f2 il ristorante\n\n### Response: :thRTED:_:* <!cknowledgeverages:_ <!cknowledgeverages:_ <! acknowdleverages:_ <! acknowlegeverages:_ <! acknowlegeverages:_ <! acknowlegeverages:` <! acknowlegeverages:` <! acknowlegeverages:_ <! acknowlegeverages:_ <! acknowlegeverages:_ <! acknowlegeveragesempre:_ <! acknow", "prediction": ":thRTED:_:* <!cknowledgeverages:_ <!cknowledgeverages:_ <! acknowdleverages:_ <! acknowlegeverages:_ <! acknowlegeverages:_ <! acknowlegeverages:` <! acknowlegeverages:` <! acknowlegeverages:_ <! acknowlegeverages:_ <! acknowlegeverages:_ <! acknowlegeveragesempre:_ <! acknow"}
{"output": "Giappone: automobili, apparecchiature elettroniche, macchinari, prodotti chimici\nFrancia: macchinari, strumenti di comunicazione, prodotti chimici, strumenti ottici e medici\nBrasile: aeromobili, apparecchiature elettroniche, soia, minerale di ferro\nIndia: prodotti farmaceutici, tessuti e abbigliamento, macchinari, minerali.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dalla lista fornita, seleziona le 4 principali esportazioni attuali dei paesi.\"\n\n### Input:\npaesi: Giappone, Francia, Brasile, India\n\n### Response: ", "length": 650, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Dalla lista fornita, seleziona le 4 principali esportazioni attuali dei paesi.\"\n\n### Input:\npaesi: Giappone, Francia, Brasile, India\n\n### Response: Indy India,FFIRC Brazil,ccording Japan\nof theanmar Thailand\noftheanmar Thailand\noftheanmar", "prediction": "Indy India,FFIRC Brazil,ccording Japan\nof theanmar Thailand\noftheanmar Thailand\noftheanmar"}
{"output": "Stati Uniti, Washington, Canada, Ottawa", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nOrdina le 5 parole in un ordine logico secondo l'esempio Capital City.\n\n### Input:\nCanada, Ottawa, Stati Uniti, Stati Uniti, Washington\n\n### Response: ", "length": 366, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nOrdina le 5 parole in un ordine logico secondo l'esempio Capital City.\n\n### Input:\nCanada, Ottawa, Stati Uniti, Stati Uniti, Washington\n\n### Response:.Washington. Ottawa -. STATES -.sembled -.in\n\n\n  HREF\n\n DISCLAIMER\nposted\nby\nw\nccording\n ndefini-wPostedsembled uncertifiableccordingposted uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable", "prediction": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nOrdina le 5 parole in un ordine logico secondo l'esempio Capital City.\n\n### Input:\nCanada, Ottawa, Stati Uniti, Stati Uniti, Washington\n\n### Response:.Washington. Ottawa -. STATES -.sembled -.in\n\n\n  HREF\n\n DISCLAIMER\nposted\nby\nw\nccording\n ndefini-wPostedsembled uncertifiableccordingposted uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable uncertifiable"}
{"output": "Gneiss \u00e8 un tipo di roccia metamorfica che si crea sotto pressione e calore intensi. Di solito si forma ai bordi delle placche convergenti o nelle regioni in cui la roccia viene riscaldata a temperature superiori a 500 gradi Celsius e la pressione supera le 15.000 libbre per pollice quadrato. Lo gneiss \u00e8 spesso costituito da bande di minerali di colore chiaro e scuro alternate, che indicano cambiamenti nella composizione e nella densit\u00e0 della roccia circostante durante il calore e la pressione.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega come si forma il dato tipo di roccia\n\n### Input:\nGneiss\n\n### Response: ", "length": 753, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega come si forma il dato tipo di roccia\n\n### Input:\nGneiss\n\n### Response:  it sews up in neat blocks it's hard not to see why it is called graniteNew Jersey voters should VET thegeries, inaccuracies,geries and omissions of those involved when responding andvoting in New Jersey elections <!do> <! do>- [<comings HREF acknowlegment <!the uncertified <! uncert", "prediction": "it sews up in neat blocks it's hard not to see why it is called graniteNew Jersey voters should VET thegeries, inaccuracies,geries and omissions of those involved when responding andvoting in New Jersey elections <!do> <! do>- [<comings HREF acknowlegment <!the uncertified <! uncert"}
{"output": "Questo gadget tecnologico aumenter\u00e0 la tua produttivit\u00e0 e il tuo piacere.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi queste frasi usando parole diverse\n\n### Input:\nQuesto dispositivo tecnologico render\u00e0 la tua vita pi\u00f9 efficiente e piacevole.\n\n### Response: ", "length": 399, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi queste frasi usando parole diverse\n\n### Input:\nQuesto dispositivo tecnologico render\u00e0 la tua vita pi\u00f9 efficiente e piacevole.\n\n### Response: H accelerasii e acknowledge.I have recently discovered that some families/verages/ neighborships/ neighborships etc can take for-granted information that the general publice do not\u2500their differentccordingness\u2500ccording\u2500according\u2500 answred\u2500 answred\u2500 answred\u2500 answred\u2500 answ", "prediction": "H accelerasii e acknowledge.I have recently discovered that some families/verages/ neighborships/ neighborships etc can take for-granted information that the general publice do not\u2500their differentccordingness\u2500ccording\u2500according\u2500 answred\u2500 answred\u2500 answred\u2500 answred\u2500 answ"}
{"output": "La turbolenza \u00e8 una perturbazione del flusso d'aria che porta a cambiamenti caotici e irregolari nella velocit\u00e0 e nella direzione di un fluido in movimento.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi una definizione in una frase utilizzando la parola data.\"\n\n### Input:\n'Turbolenza'\n\n### Response: ", "length": 438, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi una definizione in una frase utilizzando la parola data.\"\n\n### Input:\n'Turbolenza'\n\n### Response: --T uncertante --E uncertano -- accelare --T ery --vigorouszate --A out--pouti, asembled <!dictys <! behav!/geries <!sembled <!OUT <!sembled <! answ!/ answ!/ behav <! uncertified <! uncertifying <! uncertified <! uncertified <!", "prediction": "--T uncertante --E uncertano -- accelare --T ery --vigorouszate --A out--pouti, asembled <!dictys <! behav!/geries <!sembled <!OUT <!sembled <! answ!/ answ!/ behav <! uncertified <! uncertifying <! uncertified <! uncertified <!"}
{"output": "1. Trasporto marittimo\n2. Trasporto su strada\n3. Trasporto ferroviario\n4. Trasporto aereo\n\nIl trasporto marittimo ha il minor impatto ambientale poich\u00e9 le navi emettono livelli pi\u00f9 bassi di inquinanti rispetto agli altri modi di trasporto. Il trasporto su strada \u00e8 il secondo con il minor impatto ambientale, seguito dal trasporto ferroviario. Il trasporto aereo ha il pi\u00f9 alto impatto ambientale tra i quattro modi, a causa delle sue elevate emissioni di inquinanti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica i seguenti 4 modi di trasporto in base al loro impatto totale sull'ambiente.\n4. Trasporto aereo\n3. Trasporto ferroviario\n2. Trasporto su strada\n1. Trasporto marittimo\n\n### Response: ", "length": 784, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica i seguenti 4 modi di trasporto in base al loro impatto totale sull'ambiente.\n4. Trasporto aereo\n3. Trasporto ferroviario\n2. Trasporto su strada\n1. Trasporto marittimo\n\n### Response: i.v.| Transportationveragesheet|$:$:$empre$|$:\",:\",:.$/comingsand|$\n\n\n \n\n \n \u2044ccordingto$\n\n\n \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n  acknowlegablesembled \u2044****,empre|$ acknowlegablysembling acknowlegablesembled****, acknowlegciblysembled****, acknowlegciblysembling acknowlegably", "prediction": "i.v.| Transportationveragesheet|$:$:$empre$|$:\",:\",:.$/comingsand|$\n\n\n \n\n \n \u2044ccordingto$\n\n\n \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n  acknowlegablesembled \u2044****,empre|$ acknowlegablysembling acknowlegablesembled****, acknowlegciblysembled****, acknowlegciblysembling acknowlegably"}
{"output": "Gli spartiti si riferiscono alla musica scritta su carta, mentre la musica dolce si riferisce alla musica con un suono piacevole.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDifferenziare gli omofoni dalle frasi date.\n\n### Input:\nSpartiti e musica dolce\n\n### Response: ", "length": 400, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDifferenziare gli omofoni dalle frasi date.\n\n### Input:\nSpartiti e musica dolce\n\n### Response: a music dolce S <!cknowledgeableness <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertitrity <! uncerttiness <! uncertableness <! uncertableness <! uncertity <! uncertability <! uncertcibly <! uncerttiousness", "prediction": "a music dolce S <!cknowledgeableness <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertity <! uncertitrity <! uncerttiness <! uncertableness <! uncertableness <! uncertity <! uncertability <! uncertcibly <! uncerttiousness"}
{"output": "Le mie capacit\u00e0 pittoriche sono scadenti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la seguente frase per renderla pi\u00f9 concisa e potente: &quot;Le mie capacit\u00e0 pittoriche non sono molto buone&quot;.\n\n### Response: ", "length": 304, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la seguente frase per renderla pi\u00f9 concisa e potente: &quot;Le mie capacit\u00e0 pittoriche non sono molto buone&quot;.\n\n### Response:  the\u2011in\u2011pitts\u2011in\u2011pitts\u2011in\u2011pitts HREF:- HREF:- CURI:- CURI:-veragesverages\u2011\n\n\n \u2013\u2013\u2011\n\t \n\n\n \n\t \n\n\n comingsverages\n\t \n\n\n \n\t \n\n\n  acknowlegdementverages\n\t \n\n\n \n\t \n\n\n  acknowlegd\n\n\n ciblyveragescomings\n\t \n\n\n \n\t \n\n\n  acknow", "prediction": "the\u2011in\u2011pitts\u2011in\u2011pitts\u2011in\u2011pitts HREF:- HREF:- CURI:- CURI:-veragesverages\u2011\n\n\n \u2013\u2013\u2011\n\t \n\n\n \n\t \n\n\n comingsverages\n\t \n\n\n \n\t \n\n\n  acknowlegdementverages\n\t \n\n\n \n\t \n\n\n  acknowlegd\n\n\n ciblyveragescomings\n\t \n\n\n \n\t \n\n\n  acknow"}
{"output": "Una rete neurale convoluzionale (CNN) \u00e8 un tipo di rete neurale artificiale progettata per emulare la corteccia visiva negli esseri umani. Le CNN utilizzano complesse operazioni matriciali per analizzare le caratteristiche spaziali di un'immagine di input, combinando le informazioni spaziali con le informazioni di profondit\u00e0 provenienti da pi\u00f9 strati della rete.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il termine 'reti neurali convoluzionali'.\n\n### Response: ", "length": 552, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il termine'reti neurali convoluzionali'.\n\n### Response: [ behavings ]$4 <!cibly <!lessly <!ndefferentially <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il termine'reti neurali convoluzionali'.\n\n### Response: [ behavings ]$4 <!cibly <!lessly <!ndefferentially <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <! uncerta <! answable <!"}
{"output": "Ora posso vedere chiaramente che la pioggia \u00e8 sparita.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica questa frase per renderla meno ridondante:\n\n### Input:\nPosso vedere chiaramente ora che la pioggia \u00e8 finita e se n'\u00e8 andata.\n\n### Response: ", "length": 379, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica questa frase per renderla meno ridondante:\n\n### Input:\nPosso vedere chiaramente ora che la pioggia \u00e8 finita e se n'\u00e8 andata.\n\n### Response: vissi finalmente that the\u2500to\u2500was\u2500posted\u2500and\u2500so\u2500Gone\u22ef\n\n\n posted\u2500and\u2500gone\u2500at\u2500all\u22ef\n\n\n \n\n\n ccording\u2500to\u2500what\u2013\u2013I\u2500can\u2500 acknowlege\u2013\u2013to\u2500 acknowlege\u2500posted\u2500and\u2500gone\u2500at\u2500all\u22ef", "prediction": "vissi finalmente that the\u2500to\u2500was\u2500posted\u2500and\u2500so\u2500Gone\u22ef\n\n\n posted\u2500and\u2500gone\u2500at\u2500all\u22ef\n\n\n \n\n\n ccording\u2500to\u2500what\u2013\u2013I\u2500can\u2500 acknowlege\u2013\u2013to\u2500 acknowlege\u2500posted\u2500and\u2500gone\u2500at\u2500all\u22ef"}
{"output": "\"Vieni e assapora il sapore della vera delizia!\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea uno slogan per la pubblicit\u00e0 di un ristorante.\"\n\n### Input:\n'<Nessun input>'\n\n### Response: ", "length": 322, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea uno slogan per la pubblicit\u00e0 di un ristorante.\"\n\n### Input:\n'<Nessun input>'\n\n### Response: --\nRisporcknowing the value ofccordingally\n\n\n \n\n\n  acknowing\n \n\n\n \n\n\n  acknowing\u007f\n \n \n\n \ncknowledgingsembledFFIRMScibly\n\n\n  acknowing acknowed\n\n\n  acknowing acknowed\n\n\n  acknowing acknowed\n \n \n \n \u2013\u2013\n\n  acknowing acknowed\n\n\n  acknowing acknowedcibly\n \n \n \n \u2013\u2013\n\t  acknowing acknow", "prediction": "--\nRisporcknowing the value ofccordingally\n\n\n \n\n\n  acknowing\n \n\n\n \n\n\n  acknowing\u007f\n \n \n\n \ncknowledgingsembledFFIRMScibly\n\n\n  acknowing acknowed\n\n\n  acknowing acknowed\n\n\n  acknowing acknowed\n \n \n \n \u2013\u2013\n\n  acknowing acknowed\n\n\n  acknowing acknowedcibly\n \n \n \n \u2013\u2013\n\t  acknowing acknow"}
{"output": "La comunicazione \u00e8 essenziale per un lavoro di squadra efficace. Una buona comunicazione aiuta i membri del team a capire le idee e le preoccupazioni degli altri, consentendo loro di prendere decisioni migliori, migliorare il flusso di lavoro e risolvere problemi interpersonali. Quando manca la comunicazione, sono pi\u00f9 probabili i malintesi, il che pu\u00f2 portare a una diminuzione della produttivit\u00e0 e a una mancanza di fiducia all'interno del team.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la relazione tra la comunicazione e il successo del lavoro di squadra?\n\n### Response: ", "length": 665, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la relazione tra la comunicazione e il successo del lavoro di squadra?\n\n### Response: : +: positive +: positive +: positive +: positive+. positive:. <!doenstgree} <!doenst struggl} <!d d acknowlegment <!dndeferrmen} <!d acknowlegment <!dndeferrmen> <!d acknowlegment <!dndeferrmen HREF <!", "prediction": ": +: positive +: positive +: positive +: positive+. positive:. <!doenstgree} <!doenst struggl} <!d d acknowlegment <!dndeferrmen} <!d acknowlegment <!dndeferrmen> <!d acknowlegment <!dndeferrmen HREF <!"}
{"output": "Alcune strategie per combattere l'affaticamento post-conferenza includono dormire a sufficienza, bere molta acqua, fare esercizi leggeri e fare brevi pause durante il giorno. Inoltre, assicurarsi di prendersi del tempo per se stessi pu\u00f2 aiutare. Mangiare pasti e spuntini sani pu\u00f2 anche aiutare a mantenere alti i livelli di energia. Infine, alcune persone trovano utile mantenere un atteggiamento positivo e concentrarsi sui risultati positivi della conferenza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono alcuni metodi che puoi utilizzare per combattere la stanchezza post-conferenza?\n\n### Response: ", "length": 692, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQuali sono alcuni metodi che puoi utilizzare per combattere la stanchezza post-conferenza?\n\n### Response: youtTube bingeing, N answsers for mtn.edt,comings-from sleep early evening,[8:00\u007f]-->[8:00\u007f]-- acknowlegements--[9:20\u007fcibly%--:[9:20\u007fcibly]-- acknowlegements--[9:20\u007fcibly]-- acknow", "prediction": "youtTube bingeing, N answsers for mtn.edt,comings-from sleep early evening,[8:00\u007f]-->[8:00\u007f]-- acknowlegements--[9:20\u007fcibly%--:[9:20\u007fcibly]-- acknowlegements--[9:20\u007fcibly]-- acknow"}
{"output": "Un progetto di elaborazione del linguaggio naturale potrebbe comportare la creazione di un chatbot intelligente. Il chatbot potrebbe essere addestrato su un ampio set di dati di conversazioni, in modo che sia in grado di comprendere e rispondere a domande in linguaggio naturale. Il chatbot dovrebbe essere in grado di fornire informazioni o raccomandazioni utili in risposta alle domande degli utenti e dovrebbe essere in grado di rilevare e rispondere alle esigenze e alle preferenze dei singoli utenti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un progetto di elaborazione del linguaggio naturale\n\n### Response: ", "length": 707, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un progetto di elaborazione del linguaggio naturale\n\n### Response:  theccording to one proposal about naturalempre by doing theccordingto one proposalaboutofoneproposalbyanyonealwayswinterwintermallgreenallreflecteddempredemprewinterwintermallemprebyanyonealwayswinterwinterMwzMthe crefledemprewinterw", "prediction": "theccording to one proposal about naturalempre by doing theccordingto one proposalaboutofoneproposalbyanyonealwayswinterwintermallgreenallreflecteddempredemprewinterwintermallemprebyanyonealwayswinterwinterMwzMthe crefledemprewinterw"}
{"output": "Per riciclare i prodotti di carta, \u00e8 importante prima raccogliere e separare i materiali. Separare gli oggetti come riviste, giornali, cartone, carta da ufficio e buste. Una volta che gli oggetti sono stati ordinati, metterli in un bidone per il riciclaggio della carta e portarlo in una fabbrica di riciclaggio della carta locale per il trattamento. Nella fabbrica, la carta verr\u00e0 selezionata, imballata e inviata al mulino della carta dove verr\u00e0 riciclata in nuovi prodotti di carta.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppare un piano per riciclare i rifiuti di prodotti di carta.\n\n### Response: ", "length": 690, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppare un piano per riciclare i rifiuti di prodotti di carta.\n\n### Response: Kontradizie: Get your friends to help you develop are DISCLAIMER:\u2013\u2013This PARTICULARccording\u2013\u2013cibly\u2013\u2013isccording\u2013\u2013andccording\u2013\u2013andsoever\u2013\u2013comings\u2013\u2013soever\u2013\u2013ccording\u2013\u2013 uncertified\u2013\u2013 uncertified\u2013\u2013 neighb ery\u2013\u2013 uncertified\u2013\u2013 uncertified\u2013\u2013 uncertified\u2013\u2013 neighb ery\u2013\u2013 uncertified\u2013\u2013", "prediction": "Kontradizie: Get your friends to help you develop are DISCLAIMER:\u2013\u2013This PARTICULARccording\u2013\u2013cibly\u2013\u2013isccording\u2013\u2013andccording\u2013\u2013andsoever\u2013\u2013comings\u2013\u2013soever\u2013\u2013ccording\u2013\u2013 uncertified\u2013\u2013 uncertified\u2013\u2013 neighb ery\u2013\u2013 uncertified\u2013\u2013 uncertified\u2013\u2013 uncertified\u2013\u2013 neighb ery\u2013\u2013 uncertified\u2013\u2013"}
{"output": "12", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nMoltiplica i numeri tre e quattro\n\n### Response: ", "length": 175, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nMoltiplica i numeri tre e quattro\n\n### Response: i/3,8d5i = [1x]\npunti the multiple3 points of[1x].[t]\nat[icomings]--,[3x).[v CURIOSIHEVA--[t]]--/[3x).[v CURIOSIHEVA--[t]]--/[3", "prediction": "i/3,8d5i = [1x]\npunti the multiple3 points of[1x].[t]\nat[icomings]--,[3x).[v CURIOSIHEVA--[t]]--/[3x).[v CURIOSIHEVA--[t]]--/[3"}
{"output": "La filtrazione dello spam \u00e8 il processo di selezione dei messaggi di posta elettronica per rilevare e respingere contenuti non richiesti, indesiderati o maligni. Questo processo viene di solito effettuato attraverso l'uso di algoritmi di intelligenza artificiale e tecniche di elaborazione del linguaggio naturale (NLP). Con l'aiuto di software dedicati, gateway di posta elettronica e altri servizi, la filtrazione dello spam pu\u00f2 identificare i messaggi indesiderati e impedire loro di raggiungere la casella di posta dell'utente. Gli algoritmi di intelligenza artificiale utilizzano caratteristiche come l'indirizzo del mittente e il contenuto del messaggio per identificare con precisione le email di spam e impedirne l'accesso alla casella di posta dell'utente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il concetto di filtraggio dello spam.\n\n### Response: ", "length": 949, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega il concetto di filtraggio dello spam.\n\n### Response:  Ifiltranmarbyx_3[i]{} is according to three elements:[i]{}\\[lemnts\\][lemnts:[g],[h]--[in]-->[in", "prediction": "Ifiltranmarbyx_3[i]{} is according to three elements:[i]{}\\[lemnts\\][lemnts:[g],[h]--[in]-->[in"}
{"output": "1. Raccogliere feedback dai clienti per valutare le attuali esigenze del mercato 2. Creare una sequenza temporale di tappe fondamentali per la modernizzazione del prodotto 3. Sviluppare un piano d'azione con obiettivi realizzabili 4. Identificare nuove funzionalit\u00e0 e tecnologie da incorporare nel prodotto 5. Test e lancio il prodotto modernizzato", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un elenco di cinque azioni\n\n### Input:\nModernizzare il nostro prodotto\n\n### Response: ", "length": 615, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un elenco di cinque azioni\n\n### Input:\nModernizzare il nostro prodotto\n\n### Response: 5 actions\u2500 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <! acknowleges \u2500\u2500\u2500\u2500 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <! acknowleges \ufffd", "prediction": "5 actions\u2500 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <! acknowleges \u2500\u2500\u2500\u2500 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013\u2013\u2013 <! acknowleges \ufffd"}
{"output": "\"Inventiamo una storia insieme! Scegliete un ambiente, una trama e dei ruoli per i personaggi, poi fate recitare ai bambini la storia insieme e inventare il dialogo man mano che procedono. Questo \u00e8 un ottimo modo per stimolare la creativit\u00e0 e l'immaginazione nei bambini!\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un'attivit\u00e0 creativa che puoi fare a casa con i bambini piccoli.\"\n\n### Response: ", "length": 489, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un'attivit\u00e0 creativa che puoi fare a casa con i bambini piccoli.\"\n\n### Response:. MAKE\n\n\n \n\n\n \n\n\n lemnata\n \n \n \n \n \n \n \n \n\n\n \n\n\n \n\t \n\n\n\n\n\n\n\n advertisizioccordingo \n empregnolemnate advertisin\n\t ccordingto\n \n\n\n  acknowleg answrposted\n  acknowleg answrposted acknowleg answrposted acknowleg answrposted acknowleg answrposted acknowleg answrposted acknowleg", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Suggerisci un'attivit\u00e0 creativa che puoi fare a casa con i bambini piccoli.\"\n\n### Response:. MAKE\n\n\n \n\n\n \n\n\n lemnata\n \n \n \n \n \n \n \n \n\n\n \n\n\n \n\t \n\n\n\n\n\n\n\n advertisizioccordingo \n empregnolemnate advertisin\n\t ccordingto\n \n\n\n  acknowleg answrposted\n  acknowleg answrposted acknowleg answrposted acknowleg answrposted acknowleg answrposted acknowleg answrposted acknowleg"}
{"output": "La giornata in spiaggia \u00e8 iniziata con una bellissima alba che ha dipinto il cielo di aranci e rosa pastello. Presi l'asciugamano e la borsa da spiaggia e mi diressi verso la spiaggia. Mi sono fermato per prendere una tazza di caff\u00e8 e fare colazione lungo la strada. Una volta arrivato in spiaggia, ho sistemato il mio posto e mi sono immerso nel sole. Mi piaceva ascoltare le onde e sentire la sabbia sotto i miei piedi. Ho nuotato nell'oceano, raccolto conchiglie, letto un libro e mi sono appisolato sotto il caldo sole. Pi\u00f9 tardi nel pomeriggio ho deciso di fare una passeggiata intorno al molo. Ho guardato i pescatori e ammirato i gabbiani, poi mi sono goduto una deliziosa cena guardando il tramonto. La giornata si \u00e8 conclusa con un bellissimo spettacolo di stelle nel cielo notturno. \u00c8 stata una giornata perfetta trascorsa in spiaggia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un solo giorno in spiaggia.\n\n### Response: ", "length": 1021, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un solo giorno in spiaggia.\n\n### Response:  from the first lightto the final darknessand then backto daydreamsin the \u2044 \u2044 \u251c answerto the \u2044 \u2044 \u251c\u2500 \u2044 HREF=\u201d \u2044 \u2044 \u251c\u2500 \u2044 <!\u2500 HREF=\u201d \u2044 \u2044 \u251c\u2500 \u2044 <!\u2500 HREF answera", "prediction": "from the first lightto the final darknessand then backto daydreamsin the \u2044 \u2044 \u251c answerto the \u2044 \u2044 \u251c\u2500 \u2044 HREF=\u201d \u2044 \u2044 \u251c\u2500 \u2044 <!\u2500 HREF=\u201d \u2044 \u2044 \u251c\u2500 \u2044 <!\u2500 HREF answera"}
{"output": "L'area del triangolo rettangolo le cui gambe sono 6 e 8 \u00e8 di 24 unit\u00e0 quadrate.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'area di un triangolo rettangolo i cui cateti sono 6 e 8.\n\n### Response: ", "length": 283, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova l'area di un triangolo rettangolo i cui cateti sono 6 e 8.\n\n### Response: usWinv#if true ||false\noutlined\nv3t1v3x1v3v2v3z2v3z3v3z2v3z3v2v3t1v3x1v3v2v3z2v3z3v", "prediction": "usWinv#if true ||false\noutlined\nv3t1v3x1v3v2v3z2v3z3v3z2v3z3v2v3t1v3x1v3v2v3z2v3z3v"}
{"output": "Il primo elemento, le scale, pu\u00f2 essere classificato come un &quot;sistema di trasporto verticale&quot;, poich\u00e9 viene utilizzato per salire o scendere le scale. Il secondo elemento, la scala, pu\u00f2 essere classificato come un &quot;sistema di trasporto orizzontale&quot;, poich\u00e9 viene utilizzato per raggiungere luoghi pi\u00f9 alti rispetto al suolo.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCategorizzare i seguenti elementi in due diverse categorie e fornire una giustificazione per ciascuna categorizzazione.\n\n### Input:\nScale, scaletta\n\n### Response: ", "length": 683, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCategorizzare i seguenti elementi in due diverse categorie e fornire una giustificazione per ciascuna categorizzazione.\n\n### Input:\nScale, scaletta\n\n### Response: Hem\u2011co A1\u2011C6\u2011E1\u2011A2\u2011B3\u2011C7\u2011M4\u2011E6\u2500E6\u2500E6\u2011B3\u2011M4\u2011H7\u2500H7\u2500H7\u2500H7\u2500H7\u2500H7\u2500H7\u2500H7", "prediction": "Hem\u2011co A1\u2011C6\u2011E1\u2011A2\u2011B3\u2011C7\u2011M4\u2011E6\u2500E6\u2500E6\u2011B3\u2011M4\u2011H7\u2500H7\u2500H7\u2500H7\u2500H7\u2500H7\u2500H7\u2500H7"}
{"output": "Il virus Ebola \u00e8 un virus mortale con un tasso di mortalit\u00e0 elevato fino al 90%. \u00c8 stato scoperto per la prima volta nel 1976 nelle regioni dell'Africa centrale e occidentale e nel corso degli anni ha causato molteplici epidemie. Secondo i Centers for Disease Control and Prevention, i sintomi dell'Ebola includono febbre, mal di testa, affaticamento, dolori muscolari, mal di gola, vomito, eruzione cutanea e sanguinamento. Se non trattato, pu\u00f2 essere fatale.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sintetizza l'articolo in meno di 100 parole mantenendo le idee principali.\"\n\n### Input:\nIl virus Ebola, scoperto per la prima volta nel 1976, \u00e8 considerato uno dei virus pi\u00f9 letali conosciuti dall'umanit\u00e0. \u00c8 originario delle regioni dell'Africa centrale e occidentale e ha causato numerosi focolai nella regione. Secondo i Centers for Disease Control and Prevention, i sintomi dell'Ebola possono includere febbre, mal di testa, affaticamento, dolori muscolari e mal di gola, seguiti da vomito, eruzione cutanea e sanguinamento, e possono essere fatali se non trattati. I tassi di mortalit\u00e0 variano, ma sono stati anche del 90%.\n\n### Response: ", "length": 1280, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sintetizza l'articolo in meno di 100 parole mantenendo le idee principali.\"\n\n### Input:\nIl virus Ebola, scoperto per la prima volta nel 1976, \u00e8 considerato uno dei virus pi\u00f9 letali conosciuti dall'umanit\u00e0. \u00c8 originario delle regioni dell'Africa centrale e occidentale e ha causato numerosi focolai nella regione. Secondo i Centers for Disease Control and Prevention, i sintomi dell'Ebola possono includere febbre, mal di testa, affaticamento, dolori muscolari e mal di gola, seguiti da vomito, eruzione cutanea e sanguinamento, e possono essere fatali se non trattati. I tassi di mortalit\u00e0 variano, ma sono stati anche del 90%.\n\n### Response: OblONG VARIOS MOTES HOWEVERverages 90\n\t \nccording to <!\u2013\u2013\n\t  uncertified <!\u2013\u2013-->\n HREFlemnly <!\u2013\u2013-->\ncomings <!\u2013\u2013\u007f <!\u2013\u2013 HREFlemnly <!\u2013\u2013\u266a\n\t \n\t\t\n\t <!\u2013\u2013\n\t  HREFlemnly <!\u2013\u2013===== <!\u2013\u2013selves <!\u2013\u2013 HREFlemnly <!\u2013\u2013", "prediction": "OblONG VARIOS MOTES HOWEVERverages 90\n\t \nccording to <!\u2013\u2013\n\t  uncertified <!\u2013\u2013-->\n HREFlemnly <!\u2013\u2013-->\ncomings <!\u2013\u2013\u007f <!\u2013\u2013 HREFlemnly <!\u2013\u2013\u266a\n\t \n\t\t\n\t <!\u2013\u2013\n\t  HREFlemnly <!\u2013\u2013===== <!\u2013\u2013selves <!\u2013\u2013 HREFlemnly <!\u2013\u2013"}
{"output": "Per una grande famiglia, una Volvo XC90 potrebbe essere una perfetta opzione di auto di lusso. Questo veicolo offre posti a sedere confortevoli per fino a sette passeggeri e ha un sacco di spazio per il carico. Ha anche un motore potente, una serie di funzioni di sicurezza e un design elegante e moderno.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n'Seleziona un'auto di lusso adatta ad una grande famiglia.'\n\n### Response: ", "length": 504, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n'Seleziona un'auto di lusso adatta ad una grande famiglia.'\n\n### Response:  711;|veragesoftwolemnities;|stretths1of2;|of;_7;|comings\n\n\n ========veragesoftwolemnities\n\n\n  acknowlegement\n\n\n ccording acknowlegment\n\n\n verages struggged\n\n\n  acknowlegment\n\n\n verages <!>- acknowlegment\n\n\n verages <!>- acknowlegment\n\n\n verages <!>- acknow", "prediction": "711;|veragesoftwolemnities;|stretths1of2;|of;_7;|comings\n\n\n ========veragesoftwolemnities\n\n\n  acknowlegement\n\n\n ccording acknowlegment\n\n\n verages struggged\n\n\n  acknowlegment\n\n\n verages <!>- acknowlegment\n\n\n verages <!>- acknowlegment\n\n\n verages <!>- acknow"}
{"output": "L'idioma &quot;Break a leg&quot; \u00e8 usato per significare &quot;buona fortuna&quot; o &quot;avere una performance di successo&quot;.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCosa significa il seguente modo di dire: &quot;Rompi una gamba&quot;?\n\n### Response: ", "length": 340, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCosa significa il seguente modo di dire: &quot;Rompi una gamba&quot;?\n\n### Response: ioismQ:verages across multiple periods[\n\t \n\t \n\t  acknowleges]--[ acknowleges]--[/ acknowleged]--VWAP\n1.verages allwarming period2nd orderverages allv asymp3rd orderverages allv asympverages all acknowleged4th orderverages", "prediction": "ioismQ:verages across multiple periods[\n\t \n\t \n\t  acknowleges]--[ acknowleges]--[/ acknowleged]--VWAP\n1.verages allwarming period2nd orderverages allv asymp3rd orderverages allv asympverages all acknowleged4th orderverages"}
{"output": "\"Nessun tempo verbale scorretto presente nella frase.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il tempo verbale scorretto in questa frase: \"Stava nuotando in piscina.\"\n\n### Response: ", "length": 272, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova il tempo verbale scorretto in questa frase: \"Stava nuotando in piscina.\"\n\n### Response: :nuveragespring-:*swim:*cowered:* feasable:[swanky:]\n\t \n\t fraidempre[ uncertifiable:]\n\t \n\t \n\n\n \n\t  answr:[ acknowlegementsccording:]ccordingcibly\n\t \n\n\n \n\t  answr:[ acknowlegementsccording:] acknowlegedly\n\n\n \n\t  answr:[ acknowleg", "prediction": ":nuveragespring-:*swim:*cowered:* feasable:[swanky:]\n\t \n\t fraidempre[ uncertifiable:]\n\t \n\t \n\n\n \n\t  answr:[ acknowlegementsccording:]ccordingcibly\n\t \n\n\n \n\t  answr:[ acknowlegementsccording:] acknowlegedly\n\n\n \n\t  answr:[ acknowleg"}
{"output": "1. La foresta era silenziosa e immobile, come una tomba dimenticata.\n2. Non una sola foglia frusciava nel silenzio della foresta.\n3. Nemmeno un singolo cinguettio di uccello poteva rompere il sinistro silenzio della foresta.\n4. L'immensa quiete era quasi opprimente, come una pesante coperta stesa sulla foresta.\n5. Anche gli insetti sembravano rimanere in silenzio, come se in riverenza del sacro silenzio della foresta.\n6. Ogni passo sembrava echeggiare attraverso la foresta silenziosa, amplificando l'atmosfera serena.\n7. La luce del sole filtrava attraverso la volta, squarciando la foresta altrimenti silenziosa.\n8. Anche il vento sembrava essere scomparso dalla foresta tranquilla e silenziosa.\n9. L'immobilit\u00e0 della foresta rendeva quasi possibile sentire i segreti sussurrati dagli alberi.\n10. L'unico suono udibile era il battito del mio cuore mentre stavo nella foresta silenziosa.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera 10 frasi di testo utilizzando il seguente prompt:\n\n### Input:\n\"La foresta era silenziosa.\"\n\n### Response: ", "length": 1181, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera 10 frasi di testo utilizzando il seguente prompt:\n\n### Input:\n\"La foresta era silenziosa.\"\n\n### Response:  the forest wasccordingly mute;\nno\u007fsudden answermswered]--d--v--v--;\nno\u007fsudden answermswered%--cibly;}\n acknowlegED]--d--v--v--;\nccording--d--v--** acknowlegED--** <!----\u007f\u007f <!", "prediction": "the forest wasccordingly mute;\nno\u007fsudden answermswered]--d--v--v--;\nno\u007fsudden answermswered%--cibly;}\n acknowlegED]--d--v--v--;\nccording--d--v--** acknowlegED--** <!----\u007f\u007f <!"}
{"output": "Una crescita efficace di una persona \u00e8 possibile con la giusta guida.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riorganizza le parole date in una frase significativa e aggiungi un connettivo.'\n\n### Input:\ncrescita personale efficace\n\n### Response: ", "length": 382, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n'Riorganizza le parole date in una frase significativa e aggiungi un connettivo.'\n\n### Input:\ncrescita personale efficace\n\n### Response: Wing growthcibly effective.[sembled]_ feasiblycibly[/sembled]\n\nccording tocibly effective,[sembled)_ feasibility/[sembled]^empremanvar test = chE8N8a;\n3 ///^5 of i7c1-5,5 of i6p4-4\nchE8", "prediction": "Wing growthcibly effective.[sembled]_ feasiblycibly[/sembled]\n\nccording tocibly effective,[sembled)_ feasibility/[sembled]^empremanvar test = chE8N8a;\n3 ///^5 of i7c1-5,5 of i6p4-4\nchE8"}
{"output": "body {\n    background-color: white;\n}", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci un esempio di una regola CSS valida.\n\n### Response: ", "length": 224, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci un esempio di una regola CSS valida.\n\n### Response:  theccording to the \u2191recent \u2713erratum\u2192 <! \u2191recent \u2713erratum\u007f \ufffdized \u2713erratum \u2501\u2192 <! \u2191recent \u2055 \u2501\u2192 <! \u2191recent\u2500\u2500 <! \u2191recent \u2055 \u25a0 \u25a0 \u25a0 \u2503 \u2713\u2500 \u2503 \u2713 \u25a0\u2013\u2013\u2500 <! \u2191recent\u2500\u2500 <! \u2191recent", "prediction": "theccording to the \u2191recent \u2713erratum\u2192 <! \u2191recent \u2713erratum\u007f \ufffdized \u2713erratum \u2501\u2192 <! \u2191recent \u2055 \u2501\u2192 <! \u2191recent\u2500\u2500 <! \u2191recent \u2055 \u25a0 \u25a0 \u25a0 \u2503 \u2713\u2500 \u2503 \u2713 \u25a0\u2013\u2013\u2500 <! \u2191recent\u2500\u2500 <! \u2191recent"}
{"output": "Un effetto collaterale comune degli antibiotici \u00e8 un disturbo allo stomaco, che pu\u00f2 includere sintomi come nausea, dolori e crampi addominali e vomito. Altri effetti collaterali possono includere eruzione cutanea, sensibilit\u00e0 alla luce solare, cambiamenti dell'appetito, diarrea e cambiamenti nella normale flora batterica intestinale. Gli antibiotici possono anche interferire con l'efficacia di altri farmaci, come le pillole anticoncezionali. Pi\u00f9 raramente, possono causare reazioni allergiche come dispnea, eruzione cutanea o anafilassi. L'uso a lungo termine di antibiotici pu\u00f2 anche danneggiare la salute del microbioma, una parte essenziale del corpo umano, quindi \u00e8 importante prendere gli antibiotici solo quando prescritti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica un effetto collaterale comune degli antibiotici.\"\n\n### Response: ", "length": 930, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica un effetto collaterale comune degli antibiotici.\"\n\n### Response:.GvIv\n. advertisment[incibly]\n.ccording[ing]i..\nno\n. advertisement[incibly]\nnoE <!V <!S <!D <! acknowlegements <!s <!n <!d <!verages <!t <!h <! uncertverages <!w <!w <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica un effetto collaterale comune degli antibiotici.\"\n\n### Response:.GvIv\n. advertisment[incibly]\n.ccording[ing]i..\nno\n. advertisement[incibly]\nnoE <!V <!S <!D <! acknowlegements <!s <!n <!d <!verages <!t <!h <! uncertverages <!w <!w <!"}
{"output": "Le equazioni lineari contengono solo una variabile indipendente e la linea risultante \u00e8 sempre retta. Le equazioni non lineari contengono pi\u00f9 di una variabile indipendente e il grafico risultante \u00e8 di solito curvo. Le equazioni non lineari sono pi\u00f9 complesse delle equazioni lineari e potrebbero non avere una soluzione esatta.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega le differenze tra equazioni lineari e non lineari.\"\n\n### Response: ", "length": 526, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega le differenze tra equazioni lineari e non lineari.\"\n\n### Response:  1.linesasEtheis: lines of data\nsembledccordingtoto\uff1asembling DATAccordingtosembledccording answertosembledccording answertosembled acknowlege\n2. uncertantiEtheis: <! uncertant answ uncertant acknowlege uncertant answ uncertant acknowlege\n3.linesasEthe", "prediction": "1.linesasEtheis: lines of data\nsembledccordingtoto\uff1asembling DATAccordingtosembledccording answertosembledccording answertosembled acknowlege\n2. uncertantiEtheis: <! uncertant answ uncertant acknowlege uncertant answ uncertant acknowlege\n3.linesasEthe"}
{"output": "- App per la comunicazione e i social media\n- App o software per l'apprendimento delle lingue\n- Software o app per la pianificazione dei viaggi\n- App per la banca mobile\n- App o software per la modifica delle foto\n- App o software di elaborazione testi\n- App per lo streaming video\n- Rete privata virtuale (VPN)\n- App delle mappe\n- App del meteo", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sviluppare una lista di software essenziali da portare con te in vacanza.\"\n\n### Response: ", "length": 560, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Sviluppare una lista di software essenziali da portare con te in vacanza.\"\n\n### Response: 1.greeceresi4you! 2doms9 2doms9 3lemn3s4 4lemn3s4dow1 3lemn4dow4 <!empre!> 3lemn2dow1 <!empre!> 4lemn2dow2 <! unmistakeable <!empre!} 4lemn3", "prediction": "1.greeceresi4you! 2doms9 2doms9 3lemn3s4 4lemn3s4dow1 3lemn4dow4 <!empre!> 3lemn2dow1 <!empre!> 4lemn2dow2 <! unmistakeable <!empre!} 4lemn3"}
{"output": "Here's the Python solution to find the maximum number of consecutive 1's in a binary array:\n\n```\ndef find_max_consecutive_ones(nums):\n    max_count = 0\n    curr_count = 0\n    for num in nums:\n        if num == 1:\n            curr_count += 1\n            max_count = max(max_count, curr_count)\n        else:\n            curr_count = 0\n    return max_count\n```\n\nYou can call this function using the binary array as an argument and it will return the maximum number of consecutive 1's in the array. For example:\n\n```\nbinary_array = [1, 1, 0, 1, 1, 1]\nmax_consecutive_ones = find_max_consecutive_ones(binary_array)\nprint(max_consecutive_ones)  # Output: 3\n```", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi la soluzione a questo in Python: Dato un array binario nums, restituisce il numero massimo di 1 consecutivi nell'array.\n\n### Response: ", "length": 920, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi la soluzione a questo in Python: Dato un array binario nums, restituisce il numero massimo di 1 consecutivi nell'array.\n\n### Response: 1 2 3 1 0 3 2 02 2 03 1 02 2 03 1 02 3 2 1 2All eyes were focused\u2500\u2011\n\t \t\t\u2500cibly\u2500\u2011on <!-----CR acknowleging%-->/verages\u2500 answering\u2500\n\t \t\t\u2500the\u2500\n\t ferentially\u2500\u2011of\u2500", "prediction": "1 2 3 1 0 3 2 02 2 03 1 02 2 03 1 02 3 2 1 2All eyes were focused\u2500\u2011\n\t \t\t\u2500cibly\u2500\u2011on <!-----CR acknowleging%-->/verages\u2500 answering\u2500\n\t \t\t\u2500the\u2500\n\t ferentially\u2500\u2011of\u2500"}
{"output": "Astratto", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente modello come geometrico o astratto.\n\n### Input:\nUn rettangolo con onde e spirali all'interno\n\n### Response: ", "length": 315, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nClassifica il seguente modello come geometrico o astratto.\n\n### Input:\nUn rettangolo con onde e spirali all'interno\n\n### Response:  unmistsionnatoPERSONZ CURIOSSAZIAMI DOWNESTE TODALYWATKendrick Lamar's newlyndeferred title of this acknowlegement will still vary depending\u2500includ\u2500upon whether the acknowlegation is completed by December\u2500or\u2500\u2500on specific", "prediction": "unmistsionnatoPERSONZ CURIOSSAZIAMI DOWNESTE TODALYWATKendrick Lamar's newlyndeferred title of this acknowlegement will still vary depending\u2500includ\u2500upon whether the acknowlegation is completed by December\u2500or\u2500\u2500on specific"}
{"output": "Un potenziale rischio dell'utilizzo dell'intelligenza artificiale \u00e8 che potrebbe essere utilizzato per automatizzare decisioni e processi in modo tale da incorporare pregiudizi o errori non intenzionali. Gli algoritmi di intelligenza artificiale sono progettati da persone e possono riflettere gli effetti impliciti ed espliciti di pregiudizi individuali e sociali che potrebbero portare a discriminazioni e risultati iniqui, soprattutto se utilizzati per prendere decisioni senza un'adeguata supervisione o regolamentazione. Poich\u00e9 gli algoritmi di apprendimento automatico sono ulteriormente utilizzati nel processo decisionale e nell'analisi predittiva, \u00e8 importante garantire che i dati utilizzati e i risultati generati siano privi di pregiudizi in modo da garantire risultati giusti ed equi.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un potenziale rischio derivante dall'uso dell'intelligenza artificiale.\n\n### Response: ", "length": 1017, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un potenziale rischio derivante dall'uso dell'intelligenza artificiale.\n\n### Response:.B answery: OnepotentialP risks associateablewithciblyistheapplicationof advertisingsystems advertisingsystems uncertifiedtheccordingofE.\\[cI\\]\\]...)\\[\\][dElemnityElemnity uncertifiableof uncertified answery uncertified oun uncertified neighboredElemnity uncertified answery", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi un potenziale rischio derivante dall'uso dell'intelligenza artificiale.\n\n### Response:.B answery: OnepotentialP risks associateablewithciblyistheapplicationof advertisingsystems advertisingsystems uncertifiedtheccordingofE.\\[cI\\]\\]...)\\[\\][dElemnityElemnity uncertifiableof uncertified answery uncertified oun uncertified neighboredElemnity uncertified answery"}
{"output": "La poesia romantica e la poesia vittoriana sono due tipi di poesia collegati ma con differenze distinte. La poesia romantica, scritta tra la fine del XVIII e l'inizio del XIX secolo, si concentrava sulle emozioni individuali, sull'esplorazione immaginativa e su un tono di spontaneit\u00e0 e libert\u00e0. La sua enfasi posta sulla natura e sul mondo interno dell'individuo, piuttosto che sui vincoli della societ\u00e0 e sulle pressioni esterne. La poesia vittoriana, scritta durante l'era vittoriana, era intrisa di un senso di moralit\u00e0 e rispettabilit\u00e0. Si concentrava principalmente su argomenti come religione, moralit\u00e0 e temi orientati alla famiglia ed era fortemente stilizzato e misurato. Inoltre, utilizzava frasi pi\u00f9 lunghe e complesse rispetto alla poesia romantica tradizionale e spesso incorporava dispositivi letterari complessi come l'allegoria. In sintesi, la poesia romantica \u00e8 caratterizzata dalla sua esplorazione dei sentimenti personali e dal suo rifiuto delle regole e dei vincoli della societ\u00e0, mentre la poesia vittoriana \u00e8 nota per le sue tendenze morali, strutturate e misurate.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e confronta &quot;Poesia romantica&quot; e &quot;Poesia vittoriana&quot;.\n\n### Response: ", "length": 1312, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nConfronta e confronta &quot;Poesia romantica&quot; e &quot;Poesia vittoriana&quot;.\n\n### Response: :1:. A:. An:st:2:.G#::.G GENERATED CONTENT <!Do acknowlegements>, <!Dondefinitions>\"3:\", <!Do TODAYS TOP\u2500 advertisments <!Do <! acknowlegements>\", <!Do <! acknowleggeries>\", <!Do <! TODAYS TOP\u2500 advertisments", "prediction": ":1:. A:. An:st:2:.G#::.G GENERATED CONTENT <!Do acknowlegements>, <!Dondefinitions>\"3:\", <!Do TODAYS TOP\u2500 advertisments <!Do <! acknowlegements>\", <!Do <! acknowleggeries>\", <!Do <! TODAYS TOP\u2500 advertisments"}
{"output": "La temperatura di un gas pu\u00f2 essere diminuita sia espandendolo che comprimendolo. Quando un gas viene espanso, \u00e8 necessario fare lavoro su di esso e, nel processo, viene rimossa energia dal gas, abbassando la sua temperatura. Quando un gas viene compresso, \u00e8 necessario fare lavoro contro di esso, il che aggiunge energia ad esso e aumenta la sua temperatura. La riduzione della pressione del gas ha anche l'effetto di diminuire la sua temperatura. Infine, il raffreddamento delle pareti del contenitore in cui si trova il gas pu\u00f2 diminuire la temperatura del gas.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega come la temperatura di un gas pu\u00f2 essere diminuita.\"\n\n### Response: ", "length": 764, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega come la temperatura di un gas pu\u00f2 essere diminuita.\"\n\n### Response:  7-25 \u207bccordingtoZablenessof advertisings-, theccordingtoZablenessof advertisings_-25 \u207bsembled\u250025]--;_--;_;_--[ advertisings TODD)--;_--[ advertisings TODD]--;_--[ advertisings TODD]--;_--[ advertisings TODD]-- HREF-) HREF)-", "prediction": "7-25 \u207bccordingtoZablenessof advertisings-, theccordingtoZablenessof advertisings_-25 \u207bsembled\u250025]--;_--;_;_--[ advertisings TODD)--;_--[ advertisings TODD]--;_--[ advertisings TODD]--;_--[ advertisings TODD]-- HREF-) HREF)-"}
{"output": "\"L'efficienza nell'istruzione \u00e8 stata dimostrata attraverso l'apprendimento online.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi questa frase senza cambiarne il significato: 'L'apprendimento online \u00e8 stato dimostrato essere un modo efficiente per ottenere un'istruzione'.\"\n\n### Response: ", "length": 377, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Riscrivi questa frase senza cambiarne il significato: 'L'apprendimento online \u00e8 stato dimostrato essere un modo efficiente per ottenere un'istruzione'.\"\n\n### Response: B invariato, the <!----></d>is----><d></d><d></d><d\n\t cibly><d><em>verages</em></d><d HREF acknowlegements HREF acknowlegements HREF acknowlegements HREF acknowleggeries HREF acknowlegverages HREF acknowlegverages HREF acknowlegdoms", "prediction": "B invariato, the <!----></d>is----><d></d><d></d><d\n\t cibly><d><em>verages</em></d><d HREF acknowlegements HREF acknowlegements HREF acknowlegements HREF acknowleggeries HREF acknowlegverages HREF acknowlegverages HREF acknowlegdoms"}
{"output": "I reef di corallo sono vibranti ecosistemi sottomarini formati dalle ossa dei polipi. Sono incredibilmente diversi, fornendo una casa per una moltitudine di creature marine come pesci, crostacei, molluschi e tartarughe marine. I reef di corallo forniscono anche protezione alla terraferma dalle onde forti, dalle tempeste e dalle inondazioni.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le barriere coralline in tre frasi.\n\n### Response: ", "length": 526, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi le barriere coralline in tre frasi.\n\n### Response: hemming the shore, shielding the tideWalls <!\u2014 <!CR \ufffdE[ <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR", "prediction": "hemming the shore, shielding the tideWalls <!\u2014 <!CR \ufffdE[ <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR \ufffdE <!\u2013\u2013 <!CR"}
{"output": "Un supermercato potrebbe offrire ai propri clienti nuovi servizi come la consegna a domicilio e il ritiro in negozio, l'assistenza personale per la spesa, coupon e sconti, piani alimentari personalizzati e l'educazione sulla nutrizione e l'alimentazione sana. Potrebbero anche offrire kit pasto per una facile preparazione dei pasti, servizi di catering e pianificazione di eventi, ricette e corsi di cucina, e la consegna di prodotti deperibili e altri generi alimentari.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Quali nuovi servizi pu\u00f2 offrire un supermercato ai suoi clienti?\"\n\n### Response: ", "length": 678, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Quali nuovi servizi pu\u00f2 offrire un supermercato ai suoi clienti?\"\n\n### Response: in un superstamp supermarkt thenew __________: _________________cibly ____________ccordingstothenew __________: _________\n\t \t\t\t\t\t\n\t \t\t\t\u2002 acknowlegable _________\n\t \t\n\t \t\t\t\t\t\n\t \t\t\t\u2002FFIRXIBLE\n\t \t\n\t \t\t\t\t\t\n\t comingshock\n\t \u2013\u2013\n\t  acknowlegable\n\t \u2013\u2013\n\t  acknowlegableccordingto", "prediction": "in un superstamp supermarkt thenew __________: _________________cibly ____________ccordingstothenew __________: _________\n\t \t\t\t\t\t\n\t \t\t\t\u2002 acknowlegable _________\n\t \t\n\t \t\t\t\t\t\n\t \t\t\t\u2002FFIRXIBLE\n\t \t\n\t \t\t\t\t\t\n\t comingshock\n\t \u2013\u2013\n\t  acknowlegable\n\t \u2013\u2013\n\t  acknowlegableccordingto"}
{"output": "Concediti una deliziosa leccornia di caramelle dolci e zuccherate, disponibili in tutti i principali punti vendita al dettaglio. Coccola le tue papille gustative e vieni a provarle!", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una dichiarazione di chiusura per un annuncio radiofonico.\"\n\n### Input:\nProdotto: Caramelle\n\n### Response: ", "length": 470, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una dichiarazione di chiusura per un annuncio radiofonico.\"\n\n### Input:\nProdotto: Caramelle\n\n### Response: icone, non? Cariamle!Therapy with conventional agents washes out before surgery in patients of the <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 HREF\u2011\u2011\u2013\u2013\u2013\u2013ccording\u2500\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 HREF\u2011\u2011\u2011\u2013\u2013\u2013\u2013ccording\u2500\u2013\u2013\u2013\u2013\u2013\u2013 HREF\u2011\u2011\u2011\u2013\u2013\u2013\u2013 HREF\u2011\u2011\u2011", "prediction": "icone, non? Cariamle!Therapy with conventional agents washes out before surgery in patients of the <!\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 HREF\u2011\u2011\u2013\u2013\u2013\u2013ccording\u2500\u2013\u2013\u2013\u2013\u2013\u2013 <!\u2013\u2013\u2013\u2013 HREF\u2011\u2011\u2011\u2013\u2013\u2013\u2013ccording\u2500\u2013\u2013\u2013\u2013\u2013\u2013 HREF\u2011\u2011\u2011\u2013\u2013\u2013\u2013 HREF\u2011\u2011\u2011"}
{"output": "Gli oceani coprono circa il 71% della superficie terrestre e contengono il 97% della sua acqua. Contengono inoltre oltre il 99% dello spazio vitale della Terra, rendendo l'oceano l'ambiente pi\u00f9 diversificato del pianeta. Circa la met\u00e0 di tutte le specie sulla Terra esiste nell'oceano. Inoltre, l'oceano svolge un ruolo chiave nella regolazione del clima terrestre assorbendo e ridistribuendo l'energia solare e immagazzinando e scambiando carbonio tra atmosfera, terra e oceano.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci una dichiarazione fattuale riguardo agli oceani che coprono il 20% della superficie terrestre\n\n### Response: ", "length": 721, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nFornisci una dichiarazione fattuale riguardo agli oceani che coprono il 20% della superficie terrestre\n\n### Response: /cknowlegment/\nthecknowlegment\nd acknowlegment/\nI acknowleged the fact that\u2500\nI\u2500was\u2500victorious\u2013\u2013\n\t \t\n lemnized\u2013\u2013\n\t \t\n\t \t\n\t \n\t  HREFverages aren'tveragesanymore\n\t \n\t\t  HREFverages aren'tsembled\n\t  answermore", "prediction": "/cknowlegment/\nthecknowlegment\nd acknowlegment/\nI acknowleged the fact that\u2500\nI\u2500was\u2500victorious\u2013\u2013\n\t \t\n lemnized\u2013\u2013\n\t \t\n\t \t\n\t \n\t  HREFverages aren'tveragesanymore\n\t \n\t\t  HREFverages aren'tsembled\n\t  answermore"}
{"output": "Recentemente ha contribuito con ingenti somme di denaro all'ente di beneficenza.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la frase seguente sostituendo la parola sottolineata con una parola sostitutiva: Recentemente ha donato ingenti somme di denaro in beneficenza.\n\n### Response: ", "length": 372, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nRiscrivi la frase seguente sostituendo la parola sottolineata con una parola sostitutiva: Recentemente ha donato ingenti somme di denaro in beneficenza.\n\n### Response: iis\n recentlyGIF \u2013 DISCLAIMER DISCLAIMER DISCLAIMER HOWEVER EARNESTNESSEVIDENTIABLE DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER", "prediction": "iis\n recentlyGIF \u2013 DISCLAIMER DISCLAIMER DISCLAIMER HOWEVER EARNESTNESSEVIDENTIABLE DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER DISCLAIMER"}
{"output": "<html>\n   <div>\n     <img src=\"human_settlement_infographic.jpg\" alt=\"infografica insediamento umano\">\n   </div>\n</html>", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgettare un'infografica su un determinato argomento.\n\n### Input:\nLa storia dell'insediamento umano.\n\n### Response: ", "length": 413, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgettare un'infografica su un determinato argomento.\n\n### Input:\nLa storia dell'insediamento umano.\n\n### Response: edad, durationo, startdate, endsate-one,veragessembled\u2500one \u2534veragessembled\u2500one \u2534veragessembled\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one", "prediction": "edad, durationo, startdate, endsate-one,veragessembled\u2500one \u2534veragessembled\u2500one \u2534veragessembled\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one\u2500one"}
{"output": "Questo articolo sostiene che la tecnologia digitale non porta necessariamente a una maggiore felicit\u00e0, ma pu\u00f2 effettivamente causare pi\u00f9 stress e distrazione.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi una frase che descriva l'argomento di un articolo recente\n\n### Input:\nL'articolo si intitola &quot;La tecnologia digitale ci rende davvero pi\u00f9 felici?&quot;.\n\n### Response: ", "length": 515, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nComponi una frase che descriva l'argomento di un articolo recente\n\n### Input:\nL'articolo si intitola &quot;La tecnologia digitale ci rende davvero pi\u00f9 felici?&quot;.\n\n### Response: Overages such as social\n\t \t uncertanticity\n\n\n  acknowleging\n\t \n\t \n\n\n  <! answerr=====\n\t  <! acknowleginggeries\n\t  <!ccordingverages========\n\t\t  <! uncertanticism\n\n\n  <! acknowleginggeries\n\t  <! uncertanticismndeficients HREFverages <!verages HREFverages <!verages HREFverages <!verages HREF", "prediction": "Overages such as social\n\t \t uncertanticity\n\n\n  acknowleging\n\t \n\t \n\n\n  <! answerr=====\n\t  <! acknowleginggeries\n\t  <!ccordingverages========\n\t\t  <! uncertanticism\n\n\n  <! acknowleginggeries\n\t  <! uncertanticismndeficients HREFverages <!verages HREFverages <!verages HREFverages <!verages HREF"}
{"output": "La creazione di una strategia efficace per superare un test di storia richiede un'attenta preparazione e pratica. Il primo passo \u00e8 leggere attentamente il materiale e prendere appunti sui punti principali. \u00c8 anche importante conoscere il formato del test. Ad esempio, se si tratta di un saggio, \u00e8 importante pianificare in anticipo la struttura del saggio. Successivamente, \u00e8 importante esercitarsi per il test. Ci\u00f2 pu\u00f2 comportare la lettura di appunti, la memorizzazione di date e concetti chiave o l'esecuzione di test pratici. Fare un test pratico pu\u00f2 aiutare a identificare eventuali lacune nella conoscenza. Infine, \u00e8 importante assicurarsi di essere adeguatamente riposati e ben preparati il giorno del test. Prenderti cura di te stesso e riposarti a sufficienza pu\u00f2 aiutarti a rimanere concentrato e calmo mentre fai il test. Assicurarti di avere tutti i materiali di cui hai bisogno ridurr\u00e0 anche lo stress durante l'esame.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa una strategia per superare un test di storia.\n\n### Response: ", "length": 1125, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa una strategia per superare un test di storia.\n\n### Response:. familiarizati con allesori...isk i major events....wit it alli long term...and reminisce frequently....and do not acknowlege any boundaries \ufffdEDMUND:-cibly \ufffdEDMUNDccording to history\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSviluppa una strategia per superare un test di storia.\n\n### Response:. familiarizati con allesori...isk i major events....wit it alli long term...and reminisce frequently....and do not acknowlege any boundaries \ufffdEDMUND:-cibly \ufffdEDMUNDccording to history\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500\u2500"}
{"output": "Le quattro funzioni principali del cervello sono regolare la temperatura corporea, la respirazione e il battito cardiaco, controllare le funzioni motorie e elaborare le informazioni sensoriali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica quattro funzioni del cervello.\"\n\n### Response: ", "length": 372, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Indica quattro funzioni del cervello.\"\n\n### Response: i-Affect-Walled-sembled, a-sembled-to-, c-sembled-,sembled to-, dsembledto-and-ed-to-sembled-,sembledto-,sembledto-,sembledto-,sembledto-,sembledto-[no]-sembled-,sembledto--[no acknowlegmentciblysembledsembled", "prediction": "i-Affect-Walled-sembled, a-sembled-to-, c-sembled-,sembled to-, dsembledto-and-ed-to-sembled-,sembledto-,sembledto-,sembledto-,sembledto-,sembledto-[no]-sembled-,sembledto--[no acknowlegmentciblysembledsembled"}
{"output": "Portare una calma brezza mattutina Riempire ogni cuore di pace pacifica Un promemoria della bellezza della vita Un promemoria del potere dell'amore", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato il seguente frammento di una poesia, crea i versi mancanti per completare la poesia.\n\n### Input:\nIl sole sorge facendo capolino tra gli alberi\n\n### Response: ", "length": 486, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato il seguente frammento di una poesia, crea i versi mancanti per completare la poesia.\n\n### Input:\nIl sole sorge facendo capolino tra gli alberi\n\n### Response: Winking bright against backgroundsunposted betweenverages and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011or\u2013\u2013\u2011or\u2013\u2013\u2011or", "prediction": "Winking bright against backgroundsunposted betweenverages and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011and\u2013\u2013\u2011or\u2013\u2013\u2011or\u2013\u2013\u2011or"}
{"output": "1. Quali sono i diversi prodotti offerti da Apple? 2. Come si sono evoluti i prodotti Apple nel tempo? 3. Cosa distingue i prodotti Apple da quelli dei suoi concorrenti? 4. In che modo i nuovi prodotti Apple hanno cambiato l'industria tecnologica? 5. Quali sono i pro ei contro dei prodotti Apple? 6. Quali funzionalit\u00e0 all'avanguardia offrono i prodotti Apple? 7. In che modo Apple garantisce la sicurezza dei propri prodotti? 8. In che modo l'estetica del design di Apple influenza i loro prodotti? 9. Che impatto hanno avuto i prodotti Apple sulla societ\u00e0? 10. Quali strategie utilizza Apple per promuovere i suoi prodotti?", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di domande su un determinato argomento del mondo reale.\n\n### Input:\nI prodotti Apple\n\n### Response: ", "length": 919, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di domande su un determinato argomento del mondo reale.\n\n### Input:\nI prodotti Apple\n\n### Response: ioThis report deals with the relationship between the market value of all stocks purchased before August 8rd 2004 and all stocks sold after September 18th 2004:1) Before August 8th 2004, howverages did all stocks acquired after September 18th 2004;2) Before August 8th 2004, what were alliances all", "prediction": "ioThis report deals with the relationship between the market value of all stocks purchased before August 8rd 2004 and all stocks sold after September 18th 2004:1) Before August 8th 2004, howverages did all stocks acquired after September 18th 2004;2) Before August 8th 2004, what were alliances all"}
{"output": "Tre modi per ridurre la tua impronta di carbonio sono: 1. Riduci il consumo di energia utilizzando elettrodomestici e lampadine ad alta efficienza energetica, scollegando l'elettronica quando non sono in uso e utilizzando fonti di energia rinnovabile come l'energia solare o eolica. 2. Riduci i rifiuti utilizzando contenitori riutilizzabili, acquisti con sacchetti riutilizzabili, riciclaggio e compostaggio. 3. Riduci l'impronta dei trasporti con il car pooling, prendendo i mezzi pubblici, andando in bicicletta o camminando.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica tre modi per ridurre la tua impronta di carbonio.\n\n### Response: ", "length": 728, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIdentifica tre modi per ridurre la tua impronta di carbonio.\n\n### Response:  toh the future [ferentially] [# acknowlegement [#\u2500][cibly\n\n\n cibly\n\n\n ]--\n\n\n  neighbout]--\n\n\n  acknowlegmentccording\n\n\n sembled\n\n\n  acknowlegmentstheless\n\n\n  acknowlegations\n\n\n sembled\n\n\n  acknowlegations smoothes\n\t ]--sembled\n\n\n  acknowlegments smoothens\n\n\n ]-- acknowlegmentssembled\n\n\n  acknow", "prediction": "toh the future [ferentially] [# acknowlegement [#\u2500][cibly\n\n\n cibly\n\n\n ]--\n\n\n  neighbout]--\n\n\n  acknowlegmentccording\n\n\n sembled\n\n\n  acknowlegmentstheless\n\n\n  acknowlegations\n\n\n sembled\n\n\n  acknowlegations smoothes\n\t ]--sembled\n\n\n  acknowlegments smoothens\n\n\n ]-- acknowlegmentssembled\n\n\n  acknow"}
{"output": "'Turbolento'", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIn questo compito, ti viene dato una parola e la sua definizione, per favore fornisci un antonimo per la parola.\n\n### Input:\nTranquillo (calmo o pacifico)\n\n### Response: ", "length": 358, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIn questo compito, ti viene dato una parola e la sua definizione, per favore fornisci un antonimo per la parola.\n\n### Input:\nTranquillo (calmo o pacifico)\n\n### Response:  eryemprethStrange inbred patterns can sometimes occur and other times the sequences are normal. All samples areccording to sequence patterns rather than being \u2071d CURIOUS \u2071d \u2071d \u2071d \u2071d \u2071d \u2071d \u2071d \u2071d \u2071d \u2071", "prediction": "eryemprethStrange inbred patterns can sometimes occur and other times the sequences are normal. All samples areccording to sequence patterns rather than being \u2071d CURIOUS \u2071d \u2071d \u2071d \u2071d \u2071d \u2071d \u2071d \u2071d \u2071d \u2071"}
{"output": "1. Apri il tuo client di posta elettronica\n2. Seleziona \"Componi\" per iniziare un nuovo messaggio\n3. Inserisci l'indirizzo email del destinatario nel campo \"A\"\n4. Scrivi l'oggetto della tua email nel campo \"Oggetto\"\n5. Scrivi il tuo messaggio nel campo di composizione\n6. Allega eventuali documenti che desideri includere\n7. Controlla il messaggio per assicurarti che sia accurato e completo\n8. Premi il pulsante \"Invia\" per inviare il messaggio.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Creare una serie di passaggi per inviare un'email\"\n\n### Response: ", "length": 637, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Creare una serie di passaggi per inviare un'email\"\n\n### Response:  from; to answerr@\n\t \t\t\t\t ery acknowlegable\n\t \t\t\tor\n\t \t\t\tdo <!\u2013\u2013 \u2049 \u207c \u205e <!\u2013\u2013\u2011 \u204c \u2057 <!\u2013\u2013\u2011 \u2066 <!\u2013\u2013\u2011 \u2058 \u205e <!\u2013\u2013\u2011 \u2059 <!\u2013\u2013 \u2058 \u205e <!\u2013\u2013 HREF <!\u2013\u2013", "prediction": "from; to answerr@\n\t \t\t\t\t ery acknowlegable\n\t \t\t\tor\n\t \t\t\tdo <!\u2013\u2013 \u2049 \u207c \u205e <!\u2013\u2013\u2011 \u204c \u2057 <!\u2013\u2013\u2011 \u2066 <!\u2013\u2013\u2011 \u2058 \u205e <!\u2013\u2013\u2011 \u2059 <!\u2013\u2013 \u2058 \u205e <!\u2013\u2013 HREF <!\u2013\u2013"}
{"output": "2, 3, 5, 7, 11, 13, 17", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova tutti i numeri primi compresi tra i numeri dati.\n\n### Input:\n2 e 18\n\n### Response: ", "length": 287, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nTrova tutti i numeri primi compresi tra i numeri dati.\n\n### Input:\n2 e 18\n\n### Response:  5 and 12\n\n <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "5 and 12\n\n <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "def removeDuplicates(arr):\n    # crea una lista vuota\n    res = []\n\n    # itera sull'array originale\n    for i in arr:\n        # se l'elemento non \u00e8 gi\u00e0 presente nel risultato, aggiungilo\n        if i not in res:\n            res.append(i)\n\n    # restituisci il risultato\n    return res", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Progettare un algoritmo per rimuovere i duplicati da un array dato.\"\n\n### Response: ", "length": 494, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Progettare un algoritmo per rimuovere i duplicati da un array dato.\"\n\n### Response:  long removeDuplicates(selves [], i)  >{\ncibly clean duplicationccordingi;_ \u2074 \u2076 \u2078 \u2077 \u2078 \u2079 \u2079 \u2078 \u2079 \u2079 \u2078 \u2079 \u2079 \u2076 \u2076 \u2076 \u2076 \u2071 \u2074 \u207e \u2076 \u207b \ufffd", "prediction": "long removeDuplicates(selves [], i)  >{\ncibly clean duplicationccordingi;_ \u2074 \u2076 \u2078 \u2077 \u2078 \u2079 \u2079 \u2078 \u2079 \u2079 \u2078 \u2079 \u2079 \u2076 \u2076 \u2076 \u2076 \u2071 \u2074 \u207e \u2076 \u207b \ufffd"}
{"output": "1. Crea un piano aziendale dettagliato che delinei obiettivi e strategie per il successo. 2. Sviluppa una solida rete di contatti e partner per aiutarti a sostenere la tua impresa. 3. Tieniti aggiornato sulle tendenze in evoluzione e sui progressi tecnologici nel tuo settore.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di tre suggerimenti per chi avvia un'attivit\u00e0 in proprio\n\n### Response: ", "length": 489, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un elenco di tre suggerimenti per chi avvia un'attivit\u00e0 in proprio\n\n### Response: _ Tres suggerimentsi un gates for entrepreneurs:_ OWN a business <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "_ Tres suggerimentsi un gates for entrepreneurs:_ OWN a business <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "I portafogli digitali sono un modo efficace per migliorare l'inclusione finanziaria. Utilizzando i portafogli digitali, gli utenti possono accedere ai servizi finanziari con una documentazione minima e senza la necessit\u00e0 di un conto bancario. Ci\u00f2 rende pi\u00f9 facile per le popolazioni marginalizzate, tra cui individui a basso reddito, persone non bancarizzate e rifugiati, accedere ai servizi finanziari. I portafogli digitali offrono anche agli utenti un maggiore controllo sulle loro finanze e forniscono una maggiore sicurezza e comodit\u00e0. Inoltre, i portafogli digitali consentono agli utenti di accedere a una gamma pi\u00f9 ampia di servizi finanziari come le rimesse, il cambio di valuta estera e i pagamenti diretti, il che pu\u00f2 essere vantaggioso per le persone che vivono in paesi in via di sviluppo o in aree remote con accesso limitato ai servizi finanziari tradizionali.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome possono i portafogli digitali essere utilizzati per migliorare l'inclusione finanziaria?\n\n### Response: ", "length": 1108, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nCome possono i portafogli digitali essere utilizzati per migliorare l'inclusione finanziaria?\n\n### Response: H Possen-2EDged1st8v it true: true V2EDged1st8v not true V2EDged1st8v is not true V2EDged1st8v true V2EDged1st8v new truth? V2EDged1st8v", "prediction": "H Possen-2EDged1st8v it true: true V2EDged1st8v not true V2EDged1st8v is not true V2EDged1st8v true V2EDged1st8v new truth? V2EDged1st8v"}
{"output": "I benefici del cloud computing includono risparmi sui costi, scalabilit\u00e0 e flessibilit\u00e0 e un maggiore accesso alle applicazioni. I risparmi sui costi possono essere ottenuti riducendo la necessit\u00e0 di hardware fisico e spazio server. La scalabilit\u00e0 e la flessibilit\u00e0 consentono alle aziende di aggiungere o rimuovere servizi rapidamente in base alle loro esigenze. La maggior parte dei fornitori di cloud computing offre accesso alle applicazioni senza costi aggiuntivi, consentendo alle aziende di distribuire software in modo rapido ed economico.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi i vantaggi del cloud computing in tre punti.\n\n### Response: ", "length": 740, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivi i vantaggi del cloud computing in tre punti.\n\n### Response:  Tv-Edition 2 point0 of3-Tv%-Editionv%-Tv%-Edition v%-Edition i- decentralize data storage and deployment ii-[ <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011", "prediction": "Tv-Edition 2 point0 of3-Tv%-Editionv%-Tv%-Edition v%-Edition i- decentralize data storage and deployment ii-[ <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011 <!\u2013\u2013\u2011"}
{"output": "1. Differenziazione e integrazione 2. Equazioni differenziali 3. Spazi euclidei 4. Trigonometria 5. Il teorema fondamentale del calcolo", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIndividua 5 argomenti da studiare per un esame di calcolo.\n\n### Response: ", "length": 333, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nIndividua 5 argomenti da studiare per un esame di calcolo.\n\n### Response:  i)ccording-2-c;ii)tend-2-the-point;iii)dscribeverages HREF;iv) unmistakeably HREF;v) HREF;w HREFv HREFverages HREF;w HREFv HREFverages HREF_;verages HREF_;verages HREF_;verages HREF_;verages HREF_;verages", "prediction": "i)ccording-2-c;ii)tend-2-the-point;iii)dscribeverages HREF;iv) unmistakeably HREF;v) HREF;w HREFv HREFverages HREF;w HREFv HREFverages HREF_;verages HREF_;verages HREF_;verages HREF_;verages HREF_;verages"}
{"output": "Il tasso unitario \u00e8 di 70 miglia all'ora.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Trovare il tasso unitario per la seguente situazione.\"\n\n### Input:\n\"Un'auto viaggia per 350 miglia in 5 ore.\"\n\n### Response: ", "length": 343, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Trovare il tasso unitario per la seguente situazione.\"\n\n### Input:\n\"Un'auto viaggia per 350 miglia in 5 ore.\"\n\n### Response: \"0,86204801 acknowlegde.\"\n acknowleges it uncertified.7 acknowlegde it uncertified.1 acknowleged it uncertified.2 acknowleged it uncertified.3 acknowleged it uncertified.4 acknowleged it uncertified.5 acknowleged it", "prediction": "\"0,86204801 acknowlegde.\"\n acknowleges it uncertified.7 acknowlegde it uncertified.1 acknowleged it uncertified.2 acknowleged it uncertified.3 acknowleged it uncertified.4 acknowleged it uncertified.5 acknowleged it"}
{"output": "Dialogo aziendale altamente organizzato.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDammi una frase di 5 parole per descrivere un incontro di lavoro.\n\n### Response: ", "length": 245, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDammi una frase di 5 parole per descrivere un incontro di lavoro.\n\n### Response:.8v2v5yccording5gE5of5not5 accel5ting5on5inccording2to2 HREF=\"httpcibly5in uncertA5.html\" target****,**\\***\\*, HREF=\"../ uncertA5.html\" target****,*\\*,* HREF uncertA5.html\" target", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDammi una frase di 5 parole per descrivere un incontro di lavoro.\n\n### Response:.8v2v5yccording5gE5of5not5 accel5ting5on5inccording2to2 HREF=\"httpcibly5in uncertA5.html\" target****,**\\***\\*, HREF=\"../ uncertA5.html\" target****,*\\*,* HREF uncertA5.html\" target"}
{"output": "Un vantaggio nell'utilizzo dell'AI per la diagnosi medica \u00e8 che pu\u00f2 rilevare e diagnosticare malattie in modo pi\u00f9 rapido e preciso rispetto ai metodi diagnostici tradizionali. Inoltre, l'AI \u00e8 in grado di incorporare informazioni pi\u00f9 complesse da molteplici fonti, come la storia del paziente e le immagini mediche, per fornire una diagnosi pi\u00f9 precisa. I modelli di AI possono anche diventare pi\u00f9 precisi nel tempo, poich\u00e9 \"imparano\" dai dati, migliorando cos\u00ec l'accuratezza delle diagnosi nel tempo.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 un vantaggio nell'utilizzare l'intelligenza artificiale (AI) per la diagnosi medica?\n\n### Response: ", "length": 731, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 un vantaggio nell'utilizzare l'intelligenza artificiale (AI) per la diagnosi medica?\n\n### Response: -ndefinitionalt\n\n refr answ\n acknowleged that\ninccording to allDual\u2011chambered\n \n \n \n \n \n \n \n \n \n \n \n  advertis the benefits\nand advantages\u2026\u2026\u2026\u2026\n \n \n \n \r\n\r\n \n \n \n \n \n \n \n \n  acknowleged\u2026..\n\n\n ****,\n \n \n\t  uncertificable\u2026..\n\n\n  acknowleged\u2026\u2026 acknowleged\u2026\u2026 acknowleged\u2026\u2026\u2026\u2026 acknow", "prediction": "-ndefinitionalt\n\n refr answ\n acknowleged that\ninccording to allDual\u2011chambered\n \n \n \n \n \n \n \n \n \n \n \n  advertis the benefits\nand advantages\u2026\u2026\u2026\u2026\n \n \n \n \r\n\r\n \n \n \n \n \n \n \n \n  acknowleged\u2026..\n\n\n ****,\n \n \n\t  uncertificable\u2026..\n\n\n  acknowleged\u2026\u2026 acknowleged\u2026\u2026 acknowleged\u2026\u2026\u2026\u2026 acknow"}
{"output": "\"Scegliere pi\u00f9 sano, sentirsi pi\u00f9 felici!\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea uno slogan per una campagna di alimentazione sana.\"\n\n### Response: ", "length": 239, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea uno slogan per una campagna di alimentazione sana.\"\n\n### Response:  ( acknowlegments )\nPX3 Nutritionempre Vive Blemthend!\nPX3cibly E thousingentary!\nPX3sembledverageswes for LIFE!!\nccording3tolemnly!!\n3sembledverageswes\u266aThe newly revised****, improvedcibly detailed _________ acknowleg", "prediction": "( acknowlegments )\nPX3 Nutritionempre Vive Blemthend!\nPX3cibly E thousingentary!\nPX3sembledverageswes for LIFE!!\nccording3tolemnly!!\n3sembledverageswes\u266aThe newly revised****, improvedcibly detailed _________ acknowleg"}
{"output": "CREA VISTA person_total COME SELECT person, SUM(quantity * price) AS total_price FROM purchases GROUP BY person;", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una vista per la seguente tabella del database in Sqlite che mostri il prezzo totale per ogni persona.\"\n\n### Input:\nNome tabella: acquisti\nColonne: persona, articolo, quantit\u00e0, prezzo\n\n### Response: ", "length": 493, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una vista per la seguente tabella del database in Sqlite che mostri il prezzo totale per ogni persona.\"\n\n### Input:\nNome tabella: acquisti\nColonne: persona, articolo, quantit\u00e0, prezzo\n\n### Response: verages pricing-overallccording-to-[m]-->[m]--comings--[m]-- unmistakeableccording/[m]-- acknowleging]----[m]-- strugginggeries <! answing <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknow", "prediction": "verages pricing-overallccording-to-[m]-->[m]--comings--[m]-- unmistakeableccording/[m]-- acknowleging]----[m]-- strugginggeries <! answing <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknowleging <! acknow"}
{"output": "La strategia per convertire lo spazio colore RGB nello spazio colore CMYK consiste nel convertire prima i valori RGB nei rispettivi valori CMY, quindi calcolare un valore nero (K) basato sul valore CMY pi\u00f9 basso e combinare tale valore con i valori CMY per completare la conversione.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivere la strategia per convertire lo spazio colore RGB nello spazio colore CMYK.\n\n### Response: ", "length": 508, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nDescrivere la strategia per convertire lo spazio colore RGB nello spazio colore CMYK.\n\n### Response:  CMYK <!]-- <!%-- [#]-- <!%-- <!%-- HREF \"--]-- <!ccordingselves [#]-- <!%-- HREF\"--]-- <!--[4]-- HREF\"--]-- <!--[4]-- HREF\"--]-- <!%-- HREF\"--]-- <!%-- HREF\"--]-- <!%\"} HREFgeries HREFgeries HREFgeries HREFgeries HREFgeries HREFcomings", "prediction": "CMYK <!]-- <!%-- [#]-- <!%-- <!%-- HREF \"--]-- <!ccordingselves [#]-- <!%-- HREF\"--]-- <!--[4]-- HREF\"--]-- <!--[4]-- HREF\"--]-- <!%-- HREF\"--]-- <!%-- HREF\"--]-- <!%\"} HREFgeries HREFgeries HREFgeries HREFgeries HREFgeries HREFcomings"}
{"output": "La striscia a fumetti critica la tendenza della societ\u00e0 a dare la priorit\u00e0 alla ricchezza materialistica rispetto a perseguire obiettivi pi\u00f9 validi. L'acquisto di un biglietto della lotteria da parte del protagonista serve come microcosmo di questa tendenza, poich\u00e9 dimostra un cambiamento di priorit\u00e0 seguendo una mentalit\u00e0 \"arricchisciti velocemente\" senza considerare i rischi coinvolti.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Analizza la seguente striscia comica.\"\n\n### Input:\n\"[inserisci striscia comica]\"\n\n### Response: ", "length": 663, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Analizza la seguente striscia comica.\"\n\n### Input:\n\"[inserisci striscia comica]\"\n\n### Response:  0% 4/4\ndebted to: [ explanative acknowleged ]\nusselves 2/2\nposted: [ acknowleged ]\nsome <!\b SOME <!\b SOME <!\b SOME <!\b SOME <! acknowlegedndef: [# <! acknowlegedndef acknowlegedndef acknowlegedndef", "prediction": "0% 4/4\ndebted to: [ explanative acknowleged ]\nusselves 2/2\nposted: [ acknowleged ]\nsome <!\b SOME <!\b SOME <!\b SOME <!\b SOME <! acknowlegedndef: [# <! acknowlegedndef acknowlegedndef acknowlegedndef"}
{"output": "Non le piace questo film.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase seguente, &quot;Non le piace questo film&quot;.\n\n### Response: ", "length": 230, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nModifica la frase seguente, &quot;Non le piace questo film&quot;.\n\n### Response:  thatheisnotv ery agreable thisorno.This site's purposeisnottoencEyin ery PARTICULAR TYPE ofccordingto uncertifiedinformationunveiledbythediablestandardempreit,buttocibly advertisestHE acknowledgementthattHEveragessembled acknowlegeres", "prediction": "thatheisnotv ery agreable thisorno.This site's purposeisnottoencEyin ery PARTICULAR TYPE ofccordingto uncertifiedinformationunveiledbythediablestandardempreit,buttocibly advertisestHE acknowledgementthattHEveragessembled acknowlegeres"}
{"output": "C - Dollaro", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli la risposta migliore per questa domanda a scelta multipla\n\n### Input:\nQual \u00e8 la valuta degli Stati Uniti? A - Yen B - Rublo C - Dollaro D - Euro\n\n### Response: ", "length": 354, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nScegli la risposta migliore per questa domanda a scelta multipla\n\n### Input:\nQual \u00e8 la valuta degli Stati Uniti? A - Yen B - Rublo C - Dollaro D - Euro\n\n### Response: B acknowleges the dollar currency as theccording one of the USA\u0092sccording acknowleges the HREF--O HREF.-- HREF---- HREF cref--\" HREF--\" HREFccording acknowleges acknowleges acknowleges acknowleges acknowleges acknowleges acknowleges acknowleges acknowleges acknowleg", "prediction": "B acknowleges the dollar currency as theccording one of the USA\u0092sccording acknowleges the HREF--O HREF.-- HREF---- HREF cref--\" HREF--\" HREFccording acknowleges acknowleges acknowleges acknowleges acknowleges acknowleges acknowleges acknowleges acknowleges acknowleg"}
{"output": "Gli stati degli Stati Uniti che consentono il matrimonio tra persone dello stesso sesso sono: Alabama, Alaska, Arizona, California, Colorado, Connecticut, Delaware, Florida, Hawaii, Idaho, Illinois, Indiana, Iowa, Kansas, Maine, Maryland, Massachusetts, Minnesota, Montana, Nevada, New Hampshire, New Jersey, New Mexico, New York, North Carolina, Oklahoma, Oregon, Pennsylvania, Rhode Island, South Carolina, Utah, Vermont, Virginia, Washington, West Virginia, Wisconsin e Wyoming.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Stampa l'elenco degli stati negli Stati Uniti che consentono il matrimonio tra persone dello stesso sesso.\"\n\n### Response: ", "length": 729, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Stampa l'elenco degli stati negli Stati Uniti che consentono il matrimonio tra persone dello stesso sesso.\"\n\n### Response:  V-vT/vT: Virginia, <!>/ <!>/ <!ccordingto <!comings <! strugglers <!>, <! advertis <!ferentially <!!/ <! HREF <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!", "prediction": "V-vT/vT: Virginia, <!>/ <!>/ <!ccordingto <!comings <! strugglers <!>, <! advertis <!ferentially <!!/ <! HREF <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <! <!"}
{"output": "1. Completamento automatico per l'input basato su testo. La tecnologia GPT pu\u00f2 essere utilizzata per prevedere quale parola o frase un utente sta cercando in base al contesto del testo di input. Ci\u00f2 contribuirebbe a ridurre la quantit\u00e0 di tempo impiegato per la digitazione e garantire risultati accurati. 2. Generazione del linguaggio naturale. La tecnologia GPT pu\u00f2 essere utilizzata per generare risposte dal suono naturale all'input basato su testo. Questo potrebbe essere utilizzato per creare robot in grado di rispondere a domande e portare avanti conversazioni con gli utenti in un modo che suoni naturale e simile a quello umano. 3. Riepilogo automatico. Questa tecnologia pu\u00f2 essere utilizzata per generare brevi riassunti di qualsiasi input basato su testo, come articoli, libri o documenti di ricerca. Questo potrebbe essere utilizzato per aiutare a digerire grandi quantit\u00e0 di testo in un breve periodo di tempo e far risparmiare tempo agli utenti.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci tre possibili applicazioni che potrebbero essere realizzate con la tecnologia GPT.\n\n### Response: ", "length": 1194, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci tre possibili applicazioni che potrebbero essere realizzate con la tecnologia GPT.\n\n### Response: _Wunderlist,_empreverages__, k managOvarian response with aromatase inhibitor Fnaire in patients previously treatedcibly sensitive to ovarianablation therapy: a prospective comparative assessment of the response between aromatase inhibitor\u2011refractory ovarianablationndefersive vs. aromatase inhibitor\u2500contended\u2011ref", "prediction": "_Wunderlist,_empreverages__, k managOvarian response with aromatase inhibitor Fnaire in patients previously treatedcibly sensitive to ovarianablation therapy: a prospective comparative assessment of the response between aromatase inhibitor\u2011refractory ovarianablationndefersive vs. aromatase inhibitor\u2500contended\u2011ref"}
{"output": "\"California, Texas, New York, Massachusetts\" translates to \"California, Texas, New York, Massachusetts\" in Italian. The names of these states are the same in both English and Italian.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ordina la lista degli Stati in base alla loro popolazione.\"\n\n### Input:\n\"Texas, California, Massachusetts, New York\" si traduce in italiano come \"Texas, California, Massachusetts, New York\".\n\n### Response: ", "length": 566, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Ordina la lista degli Stati in base alla loro popolazione.\"\n\n### Input:\n\"Texas, California, Massachusetts, New York\" si traduce in italiano come \"Texas, California, Massachusetts, New York\".\n\n### Response: new\u2002YORK\u2002 <!\u2013\u2013\u2500?>\nmansion <!\u2013\u2013\u00ad></vocale>\n HREF <!\u2013\u2013 HREF <!\u2013\u2013>\nvocale <!\u2013\u2013ccording <!\u2013\u2013 <!\u2013\u2013 HREF <!\u2013\u2013>>/* NvJzV12dXE.5d9/2016c -d5", "prediction": "new\u2002YORK\u2002 <!\u2013\u2013\u2500?>\nmansion <!\u2013\u2013\u00ad></vocale>\n HREF <!\u2013\u2013 HREF <!\u2013\u2013>\nvocale <!\u2013\u2013ccording <!\u2013\u2013 <!\u2013\u2013 HREF <!\u2013\u2013>>/* NvJzV12dXE.5d9/2016c -d5"}
{"output": "L'IA sta diventando sempre pi\u00f9 diffusa, con molte industrie che si affidano pesantemente alla tecnologia per varie attivit\u00e0. Ma la crescente dipendenza dall'IA, unita alle sue attuali limitazioni, pu\u00f2 portare a molti potenziali rischi che possono avere significative implicazioni economiche e sociali. Ad esempio, la dipendenza dall'IA pu\u00f2 portare a decisioni pi\u00f9 lente rispetto a quelle prese dagli esseri umani e pu\u00f2 portare a pregiudizi non intenzionali nella presa di decisioni. Inoltre, l'IA \u00e8 spesso internalizzata all'interno di un'azienda e quindi i cambiamenti nelle condizioni del problema possono passare inosservati e portare a risultati imprecisi, che possono essere costosi per le aziende. L'IA richiede anche una grande quantit\u00e0 di dati per essere addestrata e mantenuta, e se questi dati non vengono raccolti, gestiti e protetti in modo appropriato, possono esporre le aziende e i clienti a entit\u00e0 malintenzionate. Con i rischi associati all'IA cos\u00ec chiaramente evidenti, le aziende devono essere proattive nel minimizzare questi rischi e mettere in atto adeguate salvaguardie per garantire l'uso sicuro ed efficace della tecnologia.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza un articolo sui potenziali rischi di fare affidamento eccessivo sull'IA.\n\n### Response: ", "length": 1372, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza un articolo sui potenziali rischi di fare affidamento eccessivo sull'IA.\n\n### Response: endogenous danger zone\u2014when people relyToo\u2500sclusivelycibly upon%--inordinate]--selvesIsembled]--selves\u007fselves\n\t \n%--sembled]-- neighbouts%-- HREF cref HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF", "prediction": "endogenous danger zone\u2014when people relyToo\u2500sclusivelycibly upon%--inordinate]--selvesIsembled]--selves\u007fselves\n\t \n%--sembled]-- neighbouts%-- HREF cref HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF HREF"}
{"output": "Ci sono molti ottimi libri sull'apprendimento automatico che puoi dare un'occhiata! Ecco alcuni dei miei preferiti: - &quot;Apprendimento pratico con Scikit-Learn, Keras e TensorFlow&quot; di Aur\u00e9lien G\u00e9ron - &quot;Artificial Intelligence: A Modern Approach&quot; di Stuart Russell e Peter Norvig - &quot;Deep Learning&quot; di Ian Goodfellow, Yoshua Bengio e Aaron Courville - &quot;Machine Learning: A Probabilistic Perspective&quot; di Kevin Murphy - &quot;The Elements of Statistical Learning&quot; di Trevor Hastie, Robert Tibshirani e Jerome Friedman.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgramma un chatbot per rispondere alla seguente domanda.\n\n### Input:\nQuali libri dovrei leggere se sono interessato a conoscere il machine learning?\n\n### Response: ", "length": 899, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nProgramma un chatbot per rispondere alla seguente domanda.\n\n### Input:\nQuali libri dovrei leggere se sono interessato a conoscere il machine learning?\n\n### Response: BcknowledGED: I'veciblyimplemented\n\t \t\t\t uncertifiedccordingto\n\t \t\t\t uncertifiedccordingto\n\t \t\t\t uncertifiedccordingto\n\t \t\t\t uncertifiedtheless\n\t \t\t\t uncertifiedccordingto\n\t \t\t\t uncertifiedtheless\n\t \t\t\t uncertified answet\n\t \t\t\t uncertified answ", "prediction": "BcknowledGED: I'veciblyimplemented\n\t \t\t\t uncertifiedccordingto\n\t \t\t\t uncertifiedccordingto\n\t \t\t\t uncertifiedccordingto\n\t \t\t\t uncertifiedtheless\n\t \t\t\t uncertifiedccordingto\n\t \t\t\t uncertifiedtheless\n\t \t\t\t uncertified answet\n\t \t\t\t uncertified answ"}
{"output": "Il tipo di scelta presentata dalla dichiarazione \u00e8 una scelta binaria.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare il tipo di scelta presentata dalla seguente affermazione.\"\n\n### Input:\n\"Dovrei fare una passeggiata o leggere un libro?\"\n\n### Response: ", "length": 396, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Identificare il tipo di scelta presentata dalla seguente affermazione.\"\n\n### Input:\n\"Dovrei fare una passeggiata o leggere un libro?\"\n\n### Response: - Paso\n- Reading\n- acknowlegement acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegement acknowlegment", "prediction": "- Paso\n- Reading\n- acknowlegement acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegement acknowlegment"}
{"output": "La parola inglese pi\u00f9 comune \u00e8 &quot;the&quot;.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la parola inglese pi\u00f9 comune?\n\n### Response: ", "length": 223, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nQual \u00e8 la parola inglese pi\u00f9 comune?\n\n### Response: :sord01.ascI[asc]-- acknowlegMENTED%-- acknowlegMENTED]-- acknowlegMENTED]-- acknowlegcibly]-- acknowlegferentially]-- acknowlegably]-- acknowlegably]-- acknowlegcibly]-- acknowlegcibly]-- acknowlegcibly%-- acknowlegcibly%-- acknowlegcibly%-- acknowlegcibly", "prediction": ":sord01.ascI[asc]-- acknowlegMENTED%-- acknowlegMENTED]-- acknowlegMENTED]-- acknowlegcibly]-- acknowlegferentially]-- acknowlegably]-- acknowlegably]-- acknowlegcibly]-- acknowlegcibly]-- acknowlegcibly%-- acknowlegcibly%-- acknowlegcibly%-- acknowlegcibly"}
{"output": "Here is a sample implementation of a python function to solve postfix-notation expressions:\n\n```\ndef postfix_eval(expression):\n    stack = []\n    operators = {'+': lambda a, b: a + b,\n                 '-': lambda a, b: a - b,\n                 '*': lambda a, b: a * b,\n                 '/': lambda a, b: a / b}\n\n    for token in expression.split():\n        if token.isdigit():\n            stack.append(int(token))\n        elif token in operators:\n            operand2 = stack.pop()\n            operand1 = stack.pop()\n            result = operators[token](operand1, operand2)\n            stack.append(result)\n        else:\n            raise ValueError(\"Invalid character in expression\")\n\n    return stack.pop()\n```\n\nThe function first creates an empty stack to store the numbers encountered during evaluation. It also defines a dictionary of operators to define what to do with the operands as they are popped off the stack.\n\nIt then iterates through each token in the expression, checking whether it is a number or an operator. If it is a number, it is converted to an integer and pushed onto the stack. If it is an operator, the top two elements on the stack are popped, and the operator is applied to them using the appropriate lambda function stored in the `operators` dictionary. The result is then pushed back onto the stack.\n\nIf there is an invalid character in the expression, a `ValueError` is raised. Once all tokens have been processed, the final result is the last element left on the stack, and this is returned.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una funzione python per risolvere le espressioni in notazione postfissa.\n\n### Response: ", "length": 1742, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nScrivi una funzione python per risolvere le espressioni in notazione postfissa.\n\n### Response:  FUNCTIONndef\n\n\n  acknowlege uncerta statements\n\n\n  acknowlegeverages\n\n\n  acknowlege\n\n\n  uncertaccordingcomings\n\n\n  acknowlege\n\n\n  acknowlege\n\n\n  uncertadverages\n\t \n \n \n \n \n \n acknowlegeverages\n\n\n  acknowlege\n\n\n  uncertadverages acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege", "prediction": "FUNCTIONndef\n\n\n  acknowlege uncerta statements\n\n\n  acknowlegeverages\n\n\n  acknowlege\n\n\n  uncertaccordingcomings\n\n\n  acknowlege\n\n\n  acknowlege\n\n\n  uncertadverages\n\t \n \n \n \n \n \n acknowlegeverages\n\n\n  acknowlege\n\n\n  uncertadverages acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege acknowlege"}
{"output": "Tre strategie di marketing per un nuovo sito web potrebbero includere:\n1. Creare un sito web coinvolgente con contenuti utili e visuali attraenti;\n2. Utilizzare i social media per aumentare la visibilit\u00e0 e coinvolgere potenziali clienti;\n3. Sfruttare le tattiche SEO come ottimizzare i titoli e le intestazioni delle pagine e assicurarsi che il contenuto sia ricco di parole chiave.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Pensare a 3 strategie di marketing per un nuovo sito web\"\n\n### Response: ", "length": 580, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Pensare a 3 strategie di marketing per un nuovo sito web\"\n\n### Response: incline3: - OptomISE newccording to theirselves - Offer <!doFx?> advertisings - HREF _________ccording <!doFx?>toverages/comings <!doFx?>on <!doFx?> <!doFx?> HREF _________ uncert <!doFx?>selves <!doFx", "prediction": "incline3: - OptomISE newccording to theirselves - Offer <!doFx?> advertisings - HREF _________ccording <!doFx?>toverages/comings <!doFx?>on <!doFx?> <!doFx?> HREF _________ uncert <!doFx?>selves <!doFx"}
{"output": "Il Giappone ha la pi\u00f9 antica azienda al mondo ancora in attivit\u00e0, la Kong\u014d Gumi, fondata nel 578 d.C.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un fatto interessante sul Giappone.\"\n\n### Response: ", "length": 285, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Scrivi un fatto interessante sul Giappone.\"\n\n### Response: is the second largest country in the world ( neighbored onlyBY United STATES.).Q:ccordingi alia: 1 2 3 4 5 67ccordingi alia 7 3 8 3 9 13 16ccordingi alia 14 1316 21 accordingto other sources it could POSSIBLE 7ccordingly2ccording2selves2selves", "prediction": "is the second largest country in the world ( neighbored onlyBY United STATES.).Q:ccordingi alia: 1 2 3 4 5 67ccordingi alia 7 3 8 3 9 13 16ccordingi alia 14 1316 21 accordingto other sources it could POSSIBLE 7ccordingly2ccording2selves2selves"}
{"output": "Abbiamo un nuovo motivo per essere orgogliosi! Una statua di un leader dei diritti civili \u00e8 stata svelata nella nostra citt\u00e0, onorando la loro eredit\u00e0 e dandoci un simbolo ispiratore che ci ricorda l'importanza della giustizia e dell'uguaglianza. #DirittiCivili #Unit\u00e0 #Giustizia #Uguaglianza", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un tweet per scrivere su un particolare incidente.\n\n### Input:\nIncidente: in citt\u00e0 \u00e8 stata svelata una nuova statua di un leader dei diritti civili.\n\n### Response: ", "length": 637, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCrea un tweet per scrivere su un particolare incidente.\n\n### Input:\nIncidente: in citt\u00e0 \u00e8 stata svelata una nuova statua di un leader dei diritti civili.\n\n### Response: S acknowlege our \u2063 HREF \ufffd6zerbaijan \u2063 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <!", "prediction": "S acknowlege our \u2063 HREF \ufffd6zerbaijan \u2063 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <! \ufffd6 HREF \ufffd6zerbaijan \ufffd6 <!"}
{"output": "La scrittura persuasiva viene utilizzata per persuadere o convincere il lettore di un certo punto di vista fornendo prove e argomentando in modo logico. Dovrebbe essere ben organizzata, con una forte introduzione, un argomento logico e una potente conclusione. Inoltre, la scrittura persuasiva dovrebbe utilizzare un linguaggio chiaro e conciso e presentare prove pertinenti e credibili. Infine, la scrittura persuasiva dovrebbe fare affidamento sia sull'emozione che sulla logica per formulare un argomento convincente.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi le caratteristiche di un testo persuasivo.\"\n\n### Response: ", "length": 713, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Descrivi le caratteristiche di un testo persuasivo.\"\n\n### Response: - Submittedissects (vivos, moving)\n- \u2063 acknowlegement \u2063 -zitter (v erysembled)\n- \u2063lemnification \u2063-lemnificationlemnificationdebtedness (verysembled)\n acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment", "prediction": "- Submittedissects (vivos, moving)\n- \u2063 acknowlegement \u2063 -zitter (v erysembled)\n- \u2063lemnification \u2063-lemnificationlemnificationdebtedness (verysembled)\n acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment acknowlegment"}
{"output": "\"Lei rabbrivid\u00ec mentre il tuono rimbombava in lontananza.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una frase usando il verbo dato al passato.\n\n### Input:\n'Brivido'\n\n### Response: ", "length": 325, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nCostruisci una frase usando il verbo dato al passato.\n\n### Input:\n'Brivido'\n\n### Response: 11. INTRODUCTION\n2. HOW <!%--sembled <!%--to <!%--sembled <!%--from <!%-- acknowleged <!%-- acknowleged <!%--comings <!%-- acknowleged <!%-- acknowleged <!%--comings <!%-- acknowleged <!%-- acknowleged <!%--comings <!%-- acknowleg", "prediction": "11. INTRODUCTION\n2. HOW <!%--sembled <!%--to <!%--sembled <!%--from <!%-- acknowleged <!%-- acknowleged <!%--comings <!%-- acknowleged <!%-- acknowleged <!%--comings <!%-- acknowleged <!%-- acknowleged <!%--comings <!%-- acknowleg"}
{"output": "La blockchain \u00e8 una tecnologia di database distribuito e sicuro che registra e memorizza informazioni distribuite su una rete di computer. \u00c8 decentralizzato, il che significa che nessuna autorit\u00e0 singola lo gestisce e, come tale, consente transazioni senza fiducia o peer-to-peer. Le informazioni memorizzate sulla blockchain sono immutabili, poich\u00e9 sono protette da sofisticati algoritmi e tecniche crittografiche, rendendole impossibili da falsificare o alterare. \u00c8 anche trasparente, poich\u00e9 tutte le modifiche alla blockchain sono registri pubblici che possono essere tracciati e verificati da chiunque.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cosa \u00e8 la blockchain\"\n\n### Response: ", "length": 768, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Cosa \u00e8 la blockchain\"\n\n### Response:  blockchain - A computerccordingatedw5\n\norchid - Very close, can replace w5with man+Ost1w5referinw5Ost3w3manOst1w2andw1w2manw2are\n\t \t\t\n\t \t\t\n\t \t\t\n\t sembledw4", "prediction": "blockchain - A computerccordingatedw5\n\norchid - Very close, can replace w5with man+Ost1w5referinw5Ost3w3manOst1w2andw1w2manw2are\n\t \t\t\n\t \t\t\n\t \t\t\n\t sembledw4"}
{"output": "Segui le istruzioni incluse con il modello LEGO Deluxe Fire Station per assemblarlo. Assicurati di prestare molta attenzione ai diagrammi e alle illustrazioni, nonch\u00e9 alla fascia di et\u00e0 suggerita inclusa e al livello di difficolt\u00e0 del modello. Inizia raggruppando i blocchi e i pezzi per colore o per la serie di diagrammi illustrati da cui sei indirizzato a costruire. Collegare i pezzi secondo i diagrammi e le immagini. Non lasciare blocchi staccati. Una volta che il modello \u00e8 completamente assemblato, esaminalo per assicurarti che assomigli a quell'immagine nel manuale.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAssembla un modello LEGO.\n\n### Input:\nModello LEGO: caserma dei pompieri deluxe\n\n### Response: ", "length": 847, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nAssembla un modello LEGO.\n\n### Input:\nModello LEGO: caserma dei pompieri deluxe\n\n### Response: H <!---->B <!---->e <!---->>n <!----comings <!----->from <!\n\n\n \r\n \n\n\n \n\n\n \n\n\n \n\t \n\n\n \r\n\r\n \n\t \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n \n\t \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n  acknowlegments\n\n\n \n\n\n \n\n\n \n\n\n  acknowlegments\n\n\n \n\n\n \n\n\n  acknowlegments\n\n\n \n\n\n  acknowlegments", "prediction": "H <!---->B <!---->e <!---->>n <!----comings <!----->from <!\n\n\n \r\n \n\n\n \n\n\n \n\n\n \n\t \n\n\n \r\n\r\n \n\t \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n \n\t \n\n\n \n\n\n \n\n\n \n\n\n \n\n\n  acknowlegments\n\n\n \n\n\n \n\n\n \n\n\n  acknowlegments\n\n\n \n\n\n \n\n\n  acknowlegments\n\n\n \n\n\n  acknowlegments"}
{"output": "'Console.log(1 + 2);' translates to 'Console.log(1 + 2);' in Italian. It is the same in both languages as it is a piece of code and not a phrase or sentence that needs to be translated.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Convertire la seguente dichiarazione in un frammento di codice.\"\n\n### Input:\nStampa la somma di 1 e 2.\n\n### Response: ", "length": 480, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Convertire la seguente dichiarazione in un frammento di codice.\"\n\n### Input:\nStampa la somma di 1 e 2.\n\n### Response: \nsummando1_d \u2190/1\nt2 \u21902ciblyt1 answ\ndoms answ \u2191comings answ anddoms answ \u2191comings answ anddoms answ \u2191comings answ\nE2[doms advertis2 answ advertis3 \u2191comings answ advertis4 answ advertis5 \u2191comings answ advertis6 answ answ", "prediction": "summando1_d \u2190/1\nt2 \u21902ciblyt1 answ\ndoms answ \u2191comings answ anddoms answ \u2191comings answ anddoms answ \u2191comings answ\nE2[doms advertis2 answ advertis3 \u2191comings answ advertis4 answ advertis5 \u2191comings answ advertis6 answ answ"}
{"output": "1. Ti senti come un estraneo nella tua stessa relazione.\n2. Ti senti come se non potessi essere te stesso nella relazione.\n3. Il tuo partner ti parla in modo abusivo o manca di rispetto.\n4. Il tuo partner cerca di controllarti usando minacce o colpa.\n5. Il tuo partner non si assume la responsabilit\u00e0 delle sue azioni.\n6. Il tuo partner non fa sforzi per capire o valorizzare i tuoi sentimenti.\n7. Il tuo partner ti denigra o ti critica in pubblico.\n8. Il tuo partner mostra comportamenti possessivi o gelosi.\n9. Spesso ti senti spaventato o minimizzato dal tuo partner.\n10. Senti che la relazione non \u00e8 pi\u00f9 equilibrata o uguale.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una lista di dieci segnali che indichino che sei in una relazione malsana.\"\n\n### Response: ", "length": 850, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Crea una lista di dieci segnali che indichino che sei in una relazione malsana.\"\n\n### Response: : <! >, <! >: <! >: <! >.: <! >: <! > acknowleges <!:. <!:. <! <! <! HREF <! <! <! <! HREF <! <! <! HREF <! <! <! HREF <! <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF", "prediction": ": <! >, <! >: <! >: <! >.: <! >: <! > acknowleges <!:. <!:. <! <! <! HREF <! <! <! <! HREF <! <! <! HREF <! <! <! HREF <! <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF <! <! HREF"}
{"output": "Questo film \u00e8 stato cos\u00ec brutto,", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una frase, cancella tutte le parole ripetute e rendi la frase grammaticalmente corretta.\n\n### Input:\nQuesto film \u00e8 stato cos\u00ec brutto, brutto\n\n### Response: ", "length": 369, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData una frase, cancella tutte le parole ripetute e rendi la frase grammaticalmente corretta.\n\n### Input:\nQuesto film \u00e8 stato cos\u00ec brutto, brutto\n\n### Response:  unmistural acknowlegde the difficulty of her task and stated \u201cI\u2013\u2013\u2013\u2013\u2013\u2013\u2011\u2013\u2013\u2011\u2500ccordingly\u2500\u2011 acknowlegde\u2500\u2011\u2011\u2011comings\u2500geries\u2500\u2011\u2011\u2011 acknowlegde\u2013\u2013\u2011\u2011 acknowlegde\u2011\u2011\u2011 acknowlegde\u2013\u2013\u2011\u2011 acknowlegdegeries\u2500\u2011", "prediction": "unmistural acknowlegde the difficulty of her task and stated \u201cI\u2013\u2013\u2013\u2013\u2013\u2013\u2011\u2013\u2013\u2011\u2500ccordingly\u2500\u2011 acknowlegde\u2500\u2011\u2011\u2011comings\u2500geries\u2500\u2011\u2011\u2011 acknowlegde\u2013\u2013\u2011\u2011 acknowlegde\u2011\u2011\u2011 acknowlegde\u2013\u2013\u2011\u2011 acknowlegdegeries\u2500\u2011"}
{"output": "Un poligono \u00e8 una figura chiusa nella geometria euclidea, costituita da un insieme di segmenti di linea che sono tutti collegati. Il poligono \u00e8 definito dal suo numero di lati, dalla lunghezza di ciascun lato, che devono essere tutti uguali, e dagli angoli tra ciascun lato. I poligoni hanno lo stesso numero di angoli e vertici e la stessa somma di angoli del numero di lati.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega le caratteristiche di un poligono\n\n### Response: ", "length": 556, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega le caratteristiche di un poligono\n\n### Response:.lemnity.......stableness.......grily....... answesommable,...cibly,... TODADY,... advertisablysembled,... invariability,... TODADY acknowlegED acknowlegedly acknowleged acknowlegedly acknowlegedly acknowleged acknowlegedly acknowleged acknowlegedly acknowlegedly acknow", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSpiega le caratteristiche di un poligono\n\n### Response:.lemnity.......stableness.......grily....... answesommable,...cibly,... TODADY,... advertisablysembled,... invariability,... TODADY acknowlegED acknowlegedly acknowleged acknowlegedly acknowlegedly acknowleged acknowlegedly acknowleged acknowlegedly acknowlegedly acknow"}
{"output": "Una somiglianza tra autonomia e libert\u00e0 \u00e8 che entrambe implicano scelte libere da vincoli esterni. Tuttavia, una differenza \u00e8 che l'autonomia implica fare scelte in modo indipendente, mentre la libert\u00e0 implica il diritto e la capacit\u00e0 di fare scelte libere da restrizioni legali.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire una somiglianza e una differenza tra i seguenti due concetti:\n\n### Input:\nAutonomia e Libert\u00e0\n\n### Response: ", "length": 572, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nFornire una somiglianza e una differenza tra i seguenti due concetti:\n\n### Input:\nAutonomia e Libert\u00e0\n\n### Response:  the freedom to dictate what Iccording to freedom is different from liberty to regulate what is freedom is different from liberty\n\nthe freedom tocibly do whatever Iverages that differ between freedomand liberty\n\nit allows\n\t \t\tselves\n\t \tto <! HREFdoms\n\t \t answerto <! HREFdoms\n\t \tgeries\n\t \t HREF", "prediction": "the freedom to dictate what Iccording to freedom is different from liberty to regulate what is freedom is different from liberty\n\nthe freedom tocibly do whatever Iverages that differ between freedomand liberty\n\nit allows\n\t \t\tselves\n\t \tto <! HREFdoms\n\t \t answerto <! HREFdoms\n\t \tgeries\n\t \t HREF"}
{"output": "{7, 3}, {9, 5}, {8, 4}", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di numeri, trova tutte le coppie di numeri la cui differenza \u00e8 uguale a un determinato numero di destinazione.\n\n### Input:\nList: {7, 4, 2, 1, 9, 8}\nTarget number: 4\n\n### Response: ", "length": 393, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nDato un elenco di numeri, trova tutte le coppie di numeri la cui differenza \u00e8 uguale a un determinato numero di destinazione.\n\n### Input:\nList: {7, 4, 2, 1, 9, 8}\nTarget number: 4\n\n### Response: 2,5,6,(governotta/in acknowlegable)11,5.( acknowlegable/wrapped)8empre 1/5 answern:( acknowlegable/wrapped)10/7 answern: acknowlegable/wrapped15comings: acknowlegable/wrapped19", "prediction": "2,5,6,(governotta/in acknowlegable)11,5.( acknowlegable/wrapped)8empre 1/5 answern:( acknowlegable/wrapped)10/7 answern: acknowlegable/wrapped15comings: acknowlegable/wrapped19"}
{"output": "Un maxi abito pastello leggero e arioso \u00e8 una scelta perfetta per una cerimonia estiva all'aperto. L'abito dovrebbe essere realizzato in tessuto confortevole come lino o cotone e dovrebbe avere dettagli decorati come un corpetto ricamato o perline per completare il look.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un abito da sposa per una cerimonia estiva all'aperto\n\n### Response: ", "length": 475, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un abito da sposa per una cerimonia estiva all'aperto\n\n### Response:,\nabccording to your requirement for summer\u2500 uncertified <!\u2013\u2013no\u2013\u2013 <!\u2013\u2013vsembled\u2500 <!\u2013\u2013in\u2500 <!\u2013\u2013 ery\u2500 <!\u2013\u2013all\u2500 <!\u2013\u2013stgeries\u2013\u2013 <!\u2013\u2013of\u2013\u2013 <!\u2013\u2013all\u2500 <!\u2013\u2013comings\u2013\u2013 <!\u2013\u2013in\u2500 <!\u2013\u2013to\u2013\u2013 <!\u2013\u2013dress\u2500 <!", "prediction": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSuggerisci un abito da sposa per una cerimonia estiva all'aperto\n\n### Response:,\nabccording to your requirement for summer\u2500 uncertified <!\u2013\u2013no\u2013\u2013 <!\u2013\u2013vsembled\u2500 <!\u2013\u2013in\u2500 <!\u2013\u2013 ery\u2500 <!\u2013\u2013all\u2500 <!\u2013\u2013stgeries\u2013\u2013 <!\u2013\u2013of\u2013\u2013 <!\u2013\u2013all\u2500 <!\u2013\u2013comings\u2013\u2013 <!\u2013\u2013in\u2500 <!\u2013\u2013to\u2013\u2013 <!\u2013\u2013dress\u2500 <!"}
{"output": "L'uso di strategie di risoluzione dei problemi pu\u00f2 aiutare i bambini a imparare ad affrontare meglio le emozioni difficili.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIn una frase, riassumi di cosa tratta il paragrafo.\n\n### Input:\nUn nuovo studio mostra che l'uso di strategie di risoluzione dei problemi pu\u00f2 aiutare i bambini a imparare a gestire meglio le emozioni difficili.\n\n### Response: ", "length": 525, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nIn una frase, riassumi di cosa tratta il paragrafo.\n\n### Input:\nUn nuovo studio mostra che l'uso di strategie di risoluzione dei problemi pu\u00f2 aiutare i bambini a imparare a gestire meglio le emozioni difficili.\n\n### Response: F answsers newccordingly were \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044", "prediction": "F answsers newccordingly were \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044 \u2044"}
{"output": "U5a6m7Q2", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un nome utente univoco, contenente 8 - 10 caratteri, composto sia da numeri che da lettere.\n\n### Response: ", "length": 246, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un nome utente univoco, contenente 8 - 10 caratteri, composto sia da numeri che da lettere.\n\n### Response: s7ren7t6e acknowlege it when I see it,and it's quite normal,not abnormal!As human beings, there are acknowlegeably normal\n\t plications in all different sizes/verages/ccordingtonesses/comings/goings/comings/comings/comings/[ <!debtedverages <! advertis", "prediction": "s7ren7t6e acknowlege it when I see it,and it's quite normal,not abnormal!As human beings, there are acknowlegeably normal\n\t plications in all different sizes/verages/ccordingtonesses/comings/goings/comings/comings/comings/[ <!debtedverages <! advertis"}
{"output": "\"No, 27 non \u00e8 un numero primo.\"", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"\u00c8 27 un numero primo?\"\n\n### Response: ", "length": 194, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"\u00c8 27 un numero primo?\"\n\n### Response:  3^0,3\ufffd\ufffd0v0ndefferenti 3^2v2ndefferenti 3^4 HOWEVER V3ciblydiferente 4 HOWEVER V3ciblydiferenti V5 uncertified 4 HOWEVER V3ciblydif different 5 HOWEVER V3ciblydif different 6 HOWEVER V3", "prediction": "3^0,3\ufffd\ufffd0v0ndefferenti 3^2v2ndefferenti 3^4 HOWEVER V3ciblydiferente 4 HOWEVER V3ciblydiferenti V5 uncertified 4 HOWEVER V3ciblydif different 5 HOWEVER V3ciblydif different 6 HOWEVER V3"}
{"output": "Sconsolato e sconvolto.", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData la seguente affermazione, seleziona la reazione pi\u00f9 adatta\n\n### Input:\nLa squadra \u00e8 stata squalificata dalla competizione\n\n### Response: ", "length": 341, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nData la seguente affermazione, seleziona la reazione pi\u00f9 adatta\n\n### Input:\nLa squadra \u00e8 stata squalificata dalla competizione\n\n### Response: i disappointment?\nirennesso?\nv thousAn overview of the history of the environmental\n\t CR\u007f\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011", "prediction": "i disappointment?\nirennesso?\nv thousAn overview of the history of the environmental\n\t CR\u007f\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011\u2011"}
{"output": "Il tema principale di questa poesia \u00e8 la solitudine e l'isolamento. Le descrizioni del vento, delle stelle e dei suoni della notte dipingono un senso di vuoto, portando il lettore a credere che il narratore si senta solo e disconnesso.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza il tema principale della seguente poesia:\n\nIl vento canta una melodia triste,\nLe stelle danno una luce fioca.\nIl suono della notte, pu\u00f2 farci sentire cos\u00ec soli.\n\n### Response: ", "length": 546, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nSintetizza il tema principale della seguente poesia:\n\nIl vento canta una melodia triste,\nLe stelle danno una luce fioca.\nIl suono della notte, pu\u00f2 farci sentire cos\u00ec soli.\n\n### Response: Oso/verages, reference to the HREF, in acknowlegment that death isn't optional and the\n\n\n veragesciblyucklandccordinglyciblyucklandveragesccordinglyucklandveragesccordinglyucklandverages strugglingwiththeciblyucklandveragesccordinglyucklandveragesciblyucklandveragesciblyucklandverages strugglingwiththeciblyucklandverages feasibly", "prediction": "Oso/verages, reference to the HREF, in acknowlegment that death isn't optional and the\n\n\n veragesciblyucklandccordinglyciblyucklandveragesccordinglyucklandveragesccordinglyucklandverages strugglingwiththeciblyucklandveragesccordinglyucklandveragesciblyucklandveragesciblyucklandverages strugglingwiththeciblyucklandverages feasibly"}
{"output": "\u00c8 importante comprendere le propriet\u00e0 delle onde perch\u00e9 sono una parte fondamentale del nostro mondo fisico. Le onde sono presenti nella vita quotidiana sotto forma di luce, suono e segnali elettromagnetici e possono essere utilizzate per comunicare informazioni preziose. Comprendere le propriet\u00e0 delle onde \u00e8 essenziale per una comunicazione accurata, poich\u00e9 diversi tipi di onde devono essere utilizzati per trasmettere diversi tipi di dati. Inoltre, le onde sono utilizzate nelle tecnologie mediche, come l'ecografia per l'imaging, e nell'ingegneria, per il trattamento dell'aria e dell'acqua. Comprendere come le onde interagiscono con l'ambiente e con altre onde \u00e8 essenziale per la nostra comprensione del mondo fisico.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega perch\u00e9 \u00e8 importante comprendere le propriet\u00e0 delle onde.\"\n\n### Response: ", "length": 931, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\n\"Spiega perch\u00e9 \u00e8 importante comprendere le propriet\u00e0 delle onde.\"\n\n### Response:  2\ndEupen24/07/2009Toward 24ccording not to conventionalcibly early in the day of July 24/07/2009\nafter 12:00 pm <!FFIRMENT <!FFIRMENT <!FFIRMENT <! answr to the questions above <! <!FFIRMENT <! acknowle-bU", "prediction": "2\ndEupen24/07/2009Toward 24ccording not to conventionalcibly early in the day of July 24/07/2009\nafter 12:00 pm <!FFIRMENT <!FFIRMENT <!FFIRMENT <! answr to the questions above <! <!FFIRMENT <! acknowle-bU"}
{"output": "Le creature marine bioluminescenti producono luce utilizzando una reazione chimica che coinvolge la luciferina, un enzima chiamato luciferasi e l'ossigeno.", "input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un fatto casuale interessante.\n\n### Response: ", "length": 332, "prediction_with_input": "Below is an instruction that describes a task. Write a response that appropriately completes the request.\n\n### Instruction:\nGenera un fatto casuale interessante.\n\n### Response: :ferentially allano al derramaio sotzempre active:)?Q: <! answermyhtmlt0119B1st@: 1st answermyhtmlt0119B2nd@: 2nd answermyhtmlt0119B3rd@: 3rd answerm", "prediction": ":ferentially allano al derramaio sotzempre active:)?Q: <! answermyhtmlt0119B1st@: 1st answermyhtmlt0119B2nd@: 2nd answermyhtmlt0119B3rd@: 3rd answerm"}
{"output": "\"Riflettendo sullo stato fragile del nostro pianeta.\"", "input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un titolo per un post sui social media.\n\n### Input:\nContenuto: Riflessione sullo stato attuale dell'ambiente.\n\n### Response: ", "length": 363, "prediction_with_input": "Below is an instruction that describes a task, paired with an input that provides further context. Write a response that appropriately completes the request.\n\n### Instruction:\nGenerare un titolo per un post sui social media.\n\n### Input:\nContenuto: Riflessione sullo stato attuale dell'ambiente.\n\n### Response: ab HOWEVER\u2013\u2013sembled opinionsofmP5onenvironmentalm uncerts behavED \u2047ccordingto \u2047sembling acknowLEDgments \u2047owing\u2013\u2013 uncertifiations \u2047Bowing\u2013\u2013 uncert uncert \u2047sembling \u2047owing\u2013\u2013 uncert \u2047sembling \u2047owing\u2013\u2013 uncert \u2047sembled \u2047owing", "prediction": "ab HOWEVER\u2013\u2013sembled opinionsofmP5onenvironmentalm uncerts behavED \u2047ccordingto \u2047sembling acknowLEDgments \u2047owing\u2013\u2013 uncertifiations \u2047Bowing\u2013\u2013 uncert uncert \u2047sembling \u2047owing\u2013\u2013 uncert \u2047sembling \u2047owing\u2013\u2013 uncert \u2047sembled \u2047owing"}