--- license: artistic-2.0 tags: - chemistry - biology - medical - gpt2 --- # DrugGPT A generative drug design model based on GPT2. ## Deployment 1. Clone ```shell git clone https://github.com/LIYUESEN/druggpt.git cd druggpt ``` Or you can visit our [GitHub repo](https://github.com/LIYUESEN/druggpt) and click *Code>Download ZIP* to download this repo. 2. Create virtual environment ```shell conda create -n druggpt python=3.7 conda activate druggpt ``` 3. Download python dependencies ```shell pip install datasets transformers scipy scikit-learn pip install torch torchvision torchaudio --index-url https://download.pytorch.org/whl/cu117 conda install -c openbabel openbabel ``` ## Example usage Run the script with the desired arguments, such as the protein sequence, ligand prompt, number of molecules to generate, and output directory. - If you want to input a protein FASTA file ```shell python drug_generator.py -f bcl2.fasta -n 50 ``` - If you want to input the amino acid sequence of the protein ```shell python drug_generator.py -p MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH -n 50 ``` - If you want to provide a prompt for the ligand ```shell python drug_generator.py -f bcl2.fasta -l COc1ccc(cc1)C(=O) -n 50 ``` - Note: If you are running in a Linux environment, you need to enclose the ligand's prompt with single quotes (''). ```shell python drug_generator.py -f bcl2.fasta -l 'COc1ccc(cc1)C(=O)' -n 50 ``` ## License [Artistic License 2.0](https://opensource.org/license/artistic-license-2-0-php/)