druggpt / README.md
wxyedward's picture
Update README.md
ce1da01
|
raw
history blame
1.58 kB
---
license: artistic-2.0
tags:
- chemistry
- biology
- medical
- gpt2
---
# DrugGPT
A generative drug design model based on GPT2.
<img src="https://img.shields.io/badge/license-Artistic%20License%202.0-green"><img src="https://img.shields.io/badge/python-3.7-blue">
## Deployment
1. Clone
```shell
git lfs install
git clone https://huggingface.co/liyuesen/druggpt
```
2. Create virtual environment
```shell
conda create -n druggpt python=3.7
conda activate druggpt
```
3. Download python dependencies
```shell
pip install datasets transformers scipy scikit-learn
pip install torch torchvision torchaudio --index-url https://download.pytorch.org/whl/cu117
conda install -c openbabel openbabel
```
## Example usage
Run the script with the desired arguments, such as the protein sequence, ligand prompt, number of molecules to generate, and output directory.
- If you want to input a protein FASTA file
```shell
python drug_generator.py -f bcl2.fasta -n 50
```
- If you want to input the amino acid sequence of the protein
```shell
python drug_generator.py -p MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH -n 50
```
- If you want to provide a prompt for the ligand
```shell
python drug_generator.py -f bcl2.fasta -l COc1ccc(cc1)C(=O) -n 50
```
## License
[Artistic License 2.0](https://opensource.org/license/artistic-license-2-0-php/)