|
--- |
|
license: artistic-2.0 |
|
tags: |
|
- chemistry |
|
- biology |
|
- medical |
|
- gpt2 |
|
--- |
|
# DrugGPT |
|
A generative drug design model based on GPT2. |
|
<img src="https://img.shields.io/badge/license-Artistic%20License%202.0-green"><img src="https://img.shields.io/badge/python-3.7-blue"><img src="https://img.shields.io/github/stars/LIYUESEN/druggpt?style=social"> |
|
## Deployment |
|
1. Clone |
|
```shell |
|
git clone https://github.com/LIYUESEN/druggpt.git |
|
cd druggpt |
|
``` |
|
Or you can visit our [GitHub repo](https://github.com/LIYUESEN/druggpt) and click *Code>Download ZIP* to download this repo. |
|
2. Create virtual environment |
|
```shell |
|
conda create -n druggpt python=3.7 |
|
conda activate druggpt |
|
``` |
|
3. Download python dependencies |
|
```shell |
|
pip install datasets transformers scipy scikit-learn |
|
pip install torch torchvision torchaudio --index-url https://download.pytorch.org/whl/cu117 |
|
conda install -c openbabel openbabel |
|
``` |
|
## Example usage |
|
Run the script with the desired arguments, such as the protein sequence, ligand prompt, number of molecules to generate, and output directory. |
|
- If you want to input a protein FASTA file |
|
```shell |
|
python drug_generator.py -f bcl2.fasta -n 50 |
|
``` |
|
- If you want to input the amino acid sequence of the protein |
|
```shell |
|
python drug_generator.py -p MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH -n 50 |
|
``` |
|
|
|
- If you want to provide a prompt for the ligand |
|
```shell |
|
python drug_generator.py -f bcl2.fasta -l COc1ccc(cc1)C(=O) -n 50 |
|
``` |
|
- Note: If you are running in a Linux environment, you need to enclose the ligand's prompt with single quotes (''). |
|
```shell |
|
python drug_generator.py -f bcl2.fasta -l 'COc1ccc(cc1)C(=O)' -n 50 |
|
``` |
|
## License |
|
[Artistic License 2.0](https://opensource.org/license/artistic-license-2-0-php/) |